Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|067680
Gene name
Locationscaffold_4:594219..596607
Strand-
Gene length (bp)2388
Transcript length (bp)1686
Coding sequence length (bp)1686
Protein length (aa) 562

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05577 Peptidase_S28 Serine carboxypeptidase S28 1.2E-55 64 502

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYS6|A1345_ARTBC Probable extracellular serine carboxypeptidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01345 PE=1 SV=1 76 472 4.0E-62
sp|P34528|YM67_CAEEL Putative serine protease K12H4.7 OS=Caenorhabditis elegans GN=K12H4.7 PE=3 SV=2 5 514 3.0E-39
sp|Q1PF50|EDA2_ARATH Probable serine protease EDA2 OS=Arabidopsis thaliana GN=EDA2 PE=2 SV=2 61 520 2.0E-37
sp|Q9NQE7|TSSP_HUMAN Thymus-specific serine protease OS=Homo sapiens GN=PRSS16 PE=2 SV=2 37 520 9.0E-24
sp|Q9QXE5|TSSP_MOUSE Thymus-specific serine protease OS=Mus musculus GN=Prss16 PE=2 SV=1 61 520 8.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYS6|A1345_ARTBC Probable extracellular serine carboxypeptidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01345 PE=1 SV=1 76 472 4.0E-62
sp|P34528|YM67_CAEEL Putative serine protease K12H4.7 OS=Caenorhabditis elegans GN=K12H4.7 PE=3 SV=2 5 514 3.0E-39
sp|Q1PF50|EDA2_ARATH Probable serine protease EDA2 OS=Arabidopsis thaliana GN=EDA2 PE=2 SV=2 61 520 2.0E-37
sp|Q9NQE7|TSSP_HUMAN Thymus-specific serine protease OS=Homo sapiens GN=PRSS16 PE=2 SV=2 37 520 9.0E-24
sp|Q9QXE5|TSSP_MOUSE Thymus-specific serine protease OS=Mus musculus GN=Prss16 PE=2 SV=1 61 520 8.0E-22
sp|P90893|YM9I_CAEEL Putative serine protease F56F10.1 OS=Caenorhabditis elegans GN=F56F10.1 PE=1 SV=2 58 228 2.0E-16
sp|Q9EPB1|DPP2_RAT Dipeptidyl peptidase 2 OS=Rattus norvegicus GN=Dpp7 PE=1 SV=1 51 515 2.0E-15
sp|Q9UHL4|DPP2_HUMAN Dipeptidyl peptidase 2 OS=Homo sapiens GN=DPP7 PE=1 SV=3 55 255 2.0E-13
sp|Q9ET22|DPP2_MOUSE Dipeptidyl peptidase 2 OS=Mus musculus GN=Dpp7 PE=1 SV=2 47 515 4.0E-12
sp|P34610|PCP1_CAEEL Putative serine protease pcp-1 OS=Caenorhabditis elegans GN=pcp-1 PE=1 SV=2 58 217 1.0E-11
sp|P34676|PCP5_CAEEL Prolyl carboxy peptidase like protein 5 OS=Caenorhabditis elegans GN=pcp-5 PE=1 SV=1 76 265 4.0E-10
sp|P42785|PCP_HUMAN Lysosomal Pro-X carboxypeptidase OS=Homo sapiens GN=PRCP PE=1 SV=1 28 217 7.0E-09
sp|Q5RBU7|PCP_PONAB Lysosomal Pro-X carboxypeptidase OS=Pongo abelii GN=PRCP PE=2 SV=1 28 217 7.0E-09
sp|Q7TMR0|PCP_MOUSE Lysosomal Pro-X carboxypeptidase OS=Mus musculus GN=Prcp PE=1 SV=2 28 217 2.0E-08
sp|Q2TA14|PCP_BOVIN Lysosomal Pro-X carboxypeptidase OS=Bos taurus GN=PRCP PE=2 SV=1 61 217 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008236 serine-type peptidase activity Yes
GO:0006508 proteolysis Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0017171 serine hydrolase activity No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 123.52 68.74 178.30
Initials Initials knots 53.85 31.58 76.11
Pileal_Stipeal_center Stage I stipe center 30.71 17.98 43.45
Pileal_Stipeal_shell Stage I stipe shell 18.54 10.26 26.82
DIF_stipe_center Stage II stipe center 86.04 50.97 121.11
DIF_stipe_shell Stage II stipe shell 112.28 66.49 158.07
DIF_stipe_skin Stage II stipe skin 49.52 29.34 69.71
DIF_cap_skin Stage II cap skin 13.39 7.13 19.65
DIF_cap_tissue Stage II cap tissue 17.38 9.33 25.42
DIF_gill_tissue Stage II gill tissue 28.10 16.21 39.98
YFB_stipe_center Young fruiting body stipe center 127.66 62.01 193.32
YFB_stipe_shell Young fruiting body stipe shell 129.22 73.65 184.79
YFB_stipe_skin Young fruiting body stipe skin 23.27 13.25 33.29
YFB_cap_skin Young fruiting body cap skin 13.51 7.21 19.81
YFB_cap_tissue Young fruiting body cap tissue 13.78 7.38 20.17
YFB_gill_tissue Young fruiting body gill tissue 14.78 8.00 21.57
YFB_veil Young fruiting body veil 12.73 6.75 18.71

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.958575 no
Casing YFB_stipe_shell 0.937073 no
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.002084 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.252194 no
Casing DIF_stipe_shell 0.846629 no
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.640833 no
DIF_gill_tissue YFB_cap_skin 0.009446 yes
DIF_gill_tissue YFB_cap_tissue 0.008791 yes
DIF_gill_tissue YFB_gill_tissue 0.024946 yes
DIF_gill_tissue YFB_veil 0.006032 yes
YFB_stipe_center YFB_stipe_shell 0.984531 no
YFB_stipe_center YFB_stipe_skin 0.000613 yes
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.000613 yes
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.073760 no
YFB_stipe_skin YFB_cap_tissue 0.080708 no
YFB_stipe_skin YFB_gill_tissue 0.151247 no
YFB_stipe_skin YFB_veil 0.050499 no
YFB_cap_skin YFB_cap_tissue 0.975278 no
YFB_cap_skin YFB_gill_tissue 0.872631 no
YFB_cap_skin YFB_veil 0.921651 no
YFB_cap_tissue YFB_gill_tissue 0.901469 no
YFB_cap_tissue YFB_veil 0.890662 no
YFB_gill_tissue YFB_veil 0.767563 no
Initials DIF_gill_tissue 0.016104 yes
Initials YFB_stipe_center 0.004160 yes
Initials YFB_stipe_shell 0.001140 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.042041 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.094657 no
Initials DIF_stipe_shell 0.003765 yes
Initials DIF_stipe_skin 0.863445 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.858816 no
Pileal_Stipeal_center YFB_stipe_center 0.000613 yes
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.435649 no
Pileal_Stipeal_center YFB_cap_skin 0.002084 yes
Pileal_Stipeal_center YFB_cap_tissue 0.003365 yes
Pileal_Stipeal_center YFB_gill_tissue 0.008457 yes
Pileal_Stipeal_center YFB_veil 0.001625 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.090151 no
Pileal_Stipeal_center DIF_stipe_center 0.000613 yes
Pileal_Stipeal_center DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_skin 0.088442 no
Pileal_Stipeal_center DIF_cap_skin 0.001140 yes
Pileal_Stipeal_center DIF_cap_tissue 0.053765 no
Pileal_Stipeal_shell DIF_gill_tissue 0.193627 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.564308 no
Pileal_Stipeal_shell YFB_cap_skin 0.390333 no
Pileal_Stipeal_shell YFB_cap_tissue 0.429462 no
Pileal_Stipeal_shell YFB_gill_tissue 0.586660 no
Pileal_Stipeal_shell YFB_veil 0.288188 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.383625 no
Pileal_Stipeal_shell DIF_cap_tissue 0.912764 no
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.269746 no
DIF_stipe_center YFB_stipe_shell 0.177942 no
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.000613 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.421464 no
DIF_stipe_center DIF_stipe_skin 0.035309 yes
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.803068 no
DIF_stipe_shell YFB_stipe_shell 0.753004 no
DIF_stipe_shell YFB_stipe_skin 0.000613 yes
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.001140 yes
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.038942 yes
DIF_stipe_skin YFB_stipe_center 0.002084 yes
DIF_stipe_skin YFB_stipe_shell 0.000613 yes
DIF_stipe_skin YFB_stipe_skin 0.002084 yes
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_veil 0.000613 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.011041 yes
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.072330 no
DIF_cap_skin YFB_cap_skin 0.986858 no
DIF_cap_skin YFB_cap_tissue 0.964497 no
DIF_cap_skin YFB_gill_tissue 0.857956 no
DIF_cap_skin YFB_veil 0.934914 no
DIF_cap_skin DIF_cap_tissue 0.525192 no
DIF_cap_tissue DIF_gill_tissue 0.120220 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.426897 no
DIF_cap_tissue YFB_cap_skin 0.540289 no
DIF_cap_tissue YFB_cap_tissue 0.580413 no
DIF_cap_tissue YFB_gill_tissue 0.735920 no
DIF_cap_tissue YFB_veil 0.419555 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|067680
MLGFVLLVASFLAIDVAQADGRPHLNMIRPPGMPLMSDSQPLGPVTSRNGTVLPPFNQTYWFDQLIDHNNPSRGT
FKQRFWHTWQFYEPGGPVLLMTPGEVNADGYADSYLSTKAISGQIAQQQNGSVVIIEHRFYGLSNPINDLKAESL
KYHTIQQAIEDLEYFIKNVILPQPDGDKLTPDKAPWVLFGGSYSGALTSWTMVNKPDLFAAGYASSAVVEAILNF
WRYFEPIREHMPANCSADVQVAISHVDEVFSGDNKTAIQEMKDLFGLGEMTHLDDVAGALRNNLWDWQSLQPTSQ
NSLFYEFCDALEVKDGVSASAEGWGLEHALQAWGNFWTEGGYLQRLCRNNSPEACLGTYDPNQPFYTDTSIDNNL
RSWMWIVCNEVGYLQEGAPKGHSSLVTRLVQPPYDLRQCQLMFPEAFEKPPKVDIKGTNKAYKGWDVRIENIFFA
NGMRDPWREATMSAEGLDVKSTPEQPIGLGDGFHCSDLSTASGLADPTILAVQQAALASMKIWLADWKPSAAHDG
ARVPAPASGSGRKPEGRTKPAPRKPLSAWSKGAGVA*
Coding >AgabiH97|067680
ATGCTCGGGTTTGTGCTCTTGGTTGCCAGTTTCCTGGCCATAGACGTCGCTCAAGCGGATGGACGACCCCACCTA
AACATGATCCGCCCGCCAGGTATGCCTCTAATGAGCGACAGCCAGCCGCTTGGTCCCGTCACTAGCCGCAATGGG
ACCGTACTTCCTCCCTTTAATCAGACCTATTGGTTCGATCAGCTCATTGATCACAATAATCCAAGCCGCGGCACT
TTCAAGCAAAGATTCTGGCACACATGGCAGTTTTACGAGCCTGGCGGGCCCGTTCTCCTCATGACTCCGGGAGAA
GTCAATGCGGATGGGTATGCGGACAGTTACCTATCGACCAAAGCTATCAGTGGTCAAATTGCCCAACAGCAAAAT
GGCAGTGTGGTCATCATTGAGCACCGATTCTACGGTCTCAGTAACCCCATCAACGACCTGAAAGCGGAAAGCTTG
AAATATCATACAATCCAGCAAGCCATTGAGGATCTAGAATACTTTATAAAGAACGTCATACTACCCCAGCCAGAC
GGTGACAAACTGACGCCTGACAAAGCCCCATGGGTTCTTTTTGGCGGCAGCTATTCCGGTGCTCTGACAAGCTGG
ACAATGGTGAATAAGCCCGACCTCTTCGCTGCAGGTTATGCCTCGTCTGCCGTGGTTGAAGCCATTCTTAATTTC
TGGCGATACTTCGAGCCTATCAGGGAGCACATGCCAGCGAACTGTTCCGCGGACGTTCAGGTCGCCATTTCGCAC
GTAGATGAGGTTTTCTCGGGGGATAACAAGACCGCGATCCAGGAGATGAAAGATCTATTCGGTTTGGGCGAAATG
ACACACCTTGACGATGTTGCCGGTGCATTGAGGAACAATCTTTGGGACTGGCAATCGTTGCAGCCCACTTCACAA
AATAGCCTGTTTTATGAGTTCTGTGATGCACTAGAGGTCAAGGACGGCGTCAGCGCTTCAGCGGAAGGTTGGGGT
CTGGAGCACGCCCTTCAGGCGTGGGGAAACTTTTGGACGGAAGGAGGCTACTTGCAGAGGCTTTGCCGCAACAAT
TCACCAGAGGCGTGTCTTGGCACATACGATCCGAACCAACCTTTCTACACGGATACATCAATCGATAACAATCTT
CGCTCGTGGATGTGGATTGTTTGTAATGAGGTCGGATACCTCCAGGAGGGAGCCCCTAAAGGCCACTCATCACTT
GTCACTCGCCTGGTTCAGCCGCCCTATGATTTACGTCAATGCCAACTCATGTTCCCTGAGGCCTTTGAGAAGCCG
CCTAAAGTTGACATCAAAGGAACAAATAAAGCTTACAAGGGCTGGGACGTTCGAATCGAGAACATATTCTTTGCT
AACGGCATGCGTGACCCATGGAGAGAGGCCACAATGTCTGCAGAGGGCCTTGATGTTAAGAGTACTCCCGAACAA
CCCATTGGCCTCGGTGACGGTTTCCATTGTTCTGATCTCTCTACTGCATCCGGGTTAGCAGATCCCACTATCCTT
GCAGTTCAGCAAGCCGCTCTTGCTTCCATGAAGATATGGCTCGCCGATTGGAAACCAAGCGCCGCTCATGACGGT
GCAAGAGTGCCTGCTCCTGCAAGTGGTTCAGGTCGAAAGCCCGAAGGCAGGACCAAGCCAGCGCCTCGTAAGCCT
CTGAGTGCTTGGAGCAAAGGTGCTGGCGTTGCATGA
Transcript >AgabiH97|067680
ATGCTCGGGTTTGTGCTCTTGGTTGCCAGTTTCCTGGCCATAGACGTCGCTCAAGCGGATGGACGACCCCACCTA
AACATGATCCGCCCGCCAGGTATGCCTCTAATGAGCGACAGCCAGCCGCTTGGTCCCGTCACTAGCCGCAATGGG
ACCGTACTTCCTCCCTTTAATCAGACCTATTGGTTCGATCAGCTCATTGATCACAATAATCCAAGCCGCGGCACT
TTCAAGCAAAGATTCTGGCACACATGGCAGTTTTACGAGCCTGGCGGGCCCGTTCTCCTCATGACTCCGGGAGAA
GTCAATGCGGATGGGTATGCGGACAGTTACCTATCGACCAAAGCTATCAGTGGTCAAATTGCCCAACAGCAAAAT
GGCAGTGTGGTCATCATTGAGCACCGATTCTACGGTCTCAGTAACCCCATCAACGACCTGAAAGCGGAAAGCTTG
AAATATCATACAATCCAGCAAGCCATTGAGGATCTAGAATACTTTATAAAGAACGTCATACTACCCCAGCCAGAC
GGTGACAAACTGACGCCTGACAAAGCCCCATGGGTTCTTTTTGGCGGCAGCTATTCCGGTGCTCTGACAAGCTGG
ACAATGGTGAATAAGCCCGACCTCTTCGCTGCAGGTTATGCCTCGTCTGCCGTGGTTGAAGCCATTCTTAATTTC
TGGCGATACTTCGAGCCTATCAGGGAGCACATGCCAGCGAACTGTTCCGCGGACGTTCAGGTCGCCATTTCGCAC
GTAGATGAGGTTTTCTCGGGGGATAACAAGACCGCGATCCAGGAGATGAAAGATCTATTCGGTTTGGGCGAAATG
ACACACCTTGACGATGTTGCCGGTGCATTGAGGAACAATCTTTGGGACTGGCAATCGTTGCAGCCCACTTCACAA
AATAGCCTGTTTTATGAGTTCTGTGATGCACTAGAGGTCAAGGACGGCGTCAGCGCTTCAGCGGAAGGTTGGGGT
CTGGAGCACGCCCTTCAGGCGTGGGGAAACTTTTGGACGGAAGGAGGCTACTTGCAGAGGCTTTGCCGCAACAAT
TCACCAGAGGCGTGTCTTGGCACATACGATCCGAACCAACCTTTCTACACGGATACATCAATCGATAACAATCTT
CGCTCGTGGATGTGGATTGTTTGTAATGAGGTCGGATACCTCCAGGAGGGAGCCCCTAAAGGCCACTCATCACTT
GTCACTCGCCTGGTTCAGCCGCCCTATGATTTACGTCAATGCCAACTCATGTTCCCTGAGGCCTTTGAGAAGCCG
CCTAAAGTTGACATCAAAGGAACAAATAAAGCTTACAAGGGCTGGGACGTTCGAATCGAGAACATATTCTTTGCT
AACGGCATGCGTGACCCATGGAGAGAGGCCACAATGTCTGCAGAGGGCCTTGATGTTAAGAGTACTCCCGAACAA
CCCATTGGCCTCGGTGACGGTTTCCATTGTTCTGATCTCTCTACTGCATCCGGGTTAGCAGATCCCACTATCCTT
GCAGTTCAGCAAGCCGCTCTTGCTTCCATGAAGATATGGCTCGCCGATTGGAAACCAAGCGCCGCTCATGACGGT
GCAAGAGTGCCTGCTCCTGCAAGTGGTTCAGGTCGAAAGCCCGAAGGCAGGACCAAGCCAGCGCCTCGTAAGCCT
CTGAGTGCTTGGAGCAAAGGTGCTGGCGTTGCATGA
Gene >AgabiH97|067680
ATGCTCGGGTTTGTGCTCTTGGTTGCCAGTTTCCTGGCCATAGACGTCGCTCAAGCGGATGGACGACCCCACCTA
AACATGATCCGCCCGCCAGGTATGCCTCTAATGAGCGACAGCCAGCCGCTTGGTCCCGTCACTAGCCGCAATGGG
ACCGTACTTCCTCCCTTTAATCAGACCTATTGGTTCGATCAGCTCATTGATCACAATAATCCAAGCCGCGGCACT
TTCAAGCAAAGATTCTGGCACACATGGCAGTTTTACGAGCCTGGTACGTCATGTTTTCATGAACTCGTATTGGGT
TGCTGAATTGCATTCAGGCGGGCCCGTTCTCCTCATGACTCCGGGAGAAGTCAATGCGGATGGTTGGTGTTATGC
GGGTTTGTATCCTCTTCCTGTGTTGACATTGTCCATCCAGGGTATGCGGACAGTTACCTATCGACCAAAGCTATC
AGTGGTCAAATTGGTAAACCACTCTTCCCCCATTACCCTTCTCTTTCTCATACCCTCTCAAATATAGCCCAACAG
CAAAATGGCAGTGTGGTCATCATTGAGCACCGATTCTACGGTCTCAGTAACCCCATCAACGACCTGAAAGCGGAA
AGCTTGAAATATCATACAATCCAGCAAGCCATTGAGGATCTAGAATACTTTATAAAGAACGTCATACTACCCCAG
CCAGACGGTGACAAACTGACGCCTGACAAAGCCCCATGGGTTCTTTTTGGCGGCAGCTATTCCGGTAAGTGATCA
GTTGCTGCTGTCAGATATCTAATACATGTTGCAATTGGCGGTATCAACAGGTGCTCTGACAAGCTGGACAATGGT
GAAGTAAGTACTGCCTCGTTTGCTTAAGGATATGCTGGTTTATCTGTTTCGCGCAGTAAGCCCGACCTCTTCGCT
GCAGGTTATGCCTCGTCTGCCGTGGTTGAAGCCATTCTGTGGGTATTCCCAACACATGTCATCAGCCAACCTTCT
CAATTATGGCAGTAATTTCTGGCGATACTTCGAGCCTATCAGGGAGCACATGCCAGCGAACTGTTCCGCGGACGT
TCAGGTCGCCATTTCGCACGTAGATGAGGTTTTCTCGGGGGATAACAAGACCGCGATCCAGGAGATGAAAGATCT
ATTCGGTTTGGGCGAAATGACACACCTTGACGATGTTGCCGGTGCATGTGAGTGGTCGAAAACTCGAGTAAAGTT
AGAATGACCCTGATTCAATCCAGTGAGGAACAATCTTTGGGACTGGCAATCGTTGCAGCCCACTTCACAAAATAG
CCTGTTTTATGAGTTCTGTGATGCACTAGAGGTCAAGGACGGCGTCAGCGCTTCAGCGGAAGGTTGGGGTCTGGA
GCACGCCCTTCAGGCGTGGGGAAACTTTTGGACGGAAGGAGGCTACTTGCAGAGGCGTGAGTTTCACGTTGTGTC
CTTGTGGTGTTGGAATTCCAGATTGATGATTCGTATCAGTTTGCCGCAACAATTCACCAGAGTATGCTTACCCTG
AACATGGAAAACTACTTGCTAACAAATAATAATGTTAATAGGGCGTGTCTTGGCACATACGATCCGAACCAACCT
TTCTACACGGATACATCAATCGATAACAATCTTCGCTCGTGGATGTGGATTGTGTAAGTTTCCGAAATATTAAGC
GAACTATGCGGCTAATTAGATGTCACGTAACAGTTGTAATGAGGTCGGATACCTCCAGGTAAGATTTTGCTCAGC
CATTCCGACGTCATTACTGACAGCCTGTCCAACAGGAGGGAGCCCCTAAAGGCCACTCATCACTTGTCACTCGCC
TGGTTCAGCCGCCCTATGATTTAGTACGCAAAATGGTTTATGTCTTCAGGCTATGGGGTCACTTATCACTTACCA
GCGTCAATGCCAACTCATGTTCCCTGAGGCCTTTGAGAAGCCGCCTAAAGTTGACATCAAAGGAACAAATAAAGC
TTACAAGGGCTGGGACGTTCGAATCGAGAACATATTCTTTGCTAACGGCATGCGTAAGTAACTTTAGCTTGCTTC
TTTTCTTAATGTTAATACAGACGCGGTGTTTGTATAGGTGACCCATGGAGAGAGGCCACAATGTCTGCAGAGGGC
CTTGATGTTAAGAGTACTCCCGAACAACCCATTGGCCTCGGTGACGGTTTCCATTGTTCTGATCTCTCTACTGCA
TCCGGGTTAGCAGATCCCACTATCCTTGCAGTTCAGCAAGCCGCTCTTGCTTCCATGAAGATATGGCTCGCCGAT
TGGAAACCAAGCGCCGCTCATGACGGTGCAAGAGTGCCTGCTCCTGCAAGTGGTTCAGGTCGAAAGCCCGAAGGC
AGGACCAAGCCAGCGCCTCGTAAGCCTCTGAGTGCTTGGAGCAAAGGTGCTGGCGTTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail