Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|067670
Gene name
Locationscaffold_4:590732..592625
Strand-
Gene length (bp)1893
Transcript length (bp)1677
Coding sequence length (bp)1677
Protein length (aa) 559

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05783 DLIC Dynein light intermediate chain (DLIC) 1.2E-32 14 271
PF05783 DLIC Dynein light intermediate chain (DLIC) 4.2E-02 312 347

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R1Q8|DC1L1_MOUSE Cytoplasmic dynein 1 light intermediate chain 1 OS=Mus musculus GN=Dync1li1 PE=1 SV=1 14 345 5.0E-30
sp|Q9QXU8|DC1L1_RAT Cytoplasmic dynein 1 light intermediate chain 1 OS=Rattus norvegicus GN=Dync1li1 PE=1 SV=1 14 345 5.0E-30
sp|Q9Y6G9|DC1L1_HUMAN Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens GN=DYNC1LI1 PE=1 SV=3 14 345 3.0E-29
sp|Q90828|DC1L1_CHICK Cytoplasmic dynein 1 light intermediate chain 1 OS=Gallus gallus GN=DYNC1LI1 PE=1 SV=1 14 360 5.0E-29
sp|Q62698|DC1L2_RAT Cytoplasmic dynein 1 light intermediate chain 2 OS=Rattus norvegicus GN=Dync1li2 PE=1 SV=1 7 356 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R1Q8|DC1L1_MOUSE Cytoplasmic dynein 1 light intermediate chain 1 OS=Mus musculus GN=Dync1li1 PE=1 SV=1 14 345 5.0E-30
sp|Q9QXU8|DC1L1_RAT Cytoplasmic dynein 1 light intermediate chain 1 OS=Rattus norvegicus GN=Dync1li1 PE=1 SV=1 14 345 5.0E-30
sp|Q9Y6G9|DC1L1_HUMAN Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens GN=DYNC1LI1 PE=1 SV=3 14 345 3.0E-29
sp|Q90828|DC1L1_CHICK Cytoplasmic dynein 1 light intermediate chain 1 OS=Gallus gallus GN=DYNC1LI1 PE=1 SV=1 14 360 5.0E-29
sp|Q62698|DC1L2_RAT Cytoplasmic dynein 1 light intermediate chain 2 OS=Rattus norvegicus GN=Dync1li2 PE=1 SV=1 7 356 1.0E-28
sp|O43237|DC1L2_HUMAN Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens GN=DYNC1LI2 PE=1 SV=1 7 356 3.0E-28
sp|Q4R5P6|DC1L2_MACFA Cytoplasmic dynein 1 light intermediate chain 2 OS=Macaca fascicularis GN=DYNC1LI2 PE=2 SV=1 7 356 4.0E-28
sp|Q5RE09|DC1L2_PONAB Cytoplasmic dynein 1 light intermediate chain 2 OS=Pongo abelii GN=DYNC1LI2 PE=2 SV=1 7 356 5.0E-28
sp|Q6PDL0|DC1L2_MOUSE Cytoplasmic dynein 1 light intermediate chain 2 OS=Mus musculus GN=Dync1li2 PE=1 SV=2 7 356 8.0E-28
sp|Q54CI8|DC1L1_DICDI Cytoplasmic dynein 1 light intermediate chain 1 OS=Dictyostelium discoideum GN=dync1li1 PE=3 SV=1 14 340 6.0E-24
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|067670
MDNSRSTTPEALPENLWSSILDSVSTSRSLPSKQILLLGQPSTGKSTIASALLQRPVSSEESQDDKRVDFAVGYE
FADVRDDGDEDTIARLSVYTVPSSNSSYTTLLPHFLHPRTALTHSLVMIVLDWTRPWSFVEELQTWLLWIERWVK
GDGSRELEMVREECRERLQSYLQHYSEPSTDLLPASTSALSNTVLPLGPGTLTHNTAGVPIIVVCSKADLIDEEN
DVVASAAGMGGMVKGKGGEWEERTDGIMQVLRTICLKYGASLFYTTPQPTTLQVLRQHALHLLFVPPPPSPAMGG
GSDAPAPVRNPFPFQHKPNTLDRDRIVVPVGWDSWGKISVLREGFDAKFWGEAWENDLEEVEGQSSGETGAKKLF
TVLVPDQGEKPRILPPINNPMPEQTFLMKHYDENSKKADRDPRASFRNPTDLTTGAPVGIVGPLGSSSFSMPNVE
RVLNDMENSTIAASNSANQAAEARKFPNRPTGRPGGIAGLNASTNATPSARTPTSPPTTSPTGGQPSQHEVLQHF
FWSLLNSKDRAGGKDPNAANTSPPAKTNGQTEE*
Coding >AgabiH97|067670
ATGGATAATTCGCGTTCAACAACGCCGGAAGCACTACCCGAAAATCTCTGGTCATCTATCTTAGATTCTGTGTCG
ACATCCCGCTCTCTTCCCTCAAAACAAATCCTGCTTCTTGGACAACCCTCAACCGGAAAGTCGACAATCGCATCT
GCACTGCTACAGAGACCTGTATCTTCTGAAGAAAGTCAGGATGATAAGAGGGTGGACTTTGCCGTTGGTTATGAG
TTTGCTGACGTTAGGGACGACGGTGATGAAGATACTATAGCGCGGTTATCGGTCTATACCGTGCCGTCGTCAAAT
TCATCATATACAACATTGTTGCCACACTTTCTGCATCCAAGAACGGCACTAACACACTCGTTGGTGATGATCGTA
CTAGATTGGACGAGACCATGGTCGTTTGTGGAGGAACTACAGACTTGGTTACTATGGATTGAACGATGGGTCAAA
GGAGATGGTTCCAGAGAGCTTGAGATGGTGCGCGAAGAGTGCCGTGAGCGATTACAGTCATATCTGCAACATTAT
TCTGAGCCGTCTACTGATCTGCTGCCTGCATCTACCTCTGCATTGAGTAACACCGTCTTACCCCTTGGCCCAGGT
ACATTGACACACAATACTGCGGGCGTGCCAATAATTGTTGTGTGTAGCAAGGCAGATTTGATAGACGAAGAAAAT
GACGTGGTTGCTAGTGCTGCAGGTATGGGTGGCATGGTTAAAGGGAAGGGTGGTGAGTGGGAGGAGCGAACGGAC
GGAATCATGCAGGTTCTACGGACGATCTGCCTTAAGTATGGTGCATCACTATTCTACACGACCCCTCAACCCACC
ACTCTCCAGGTTCTGCGACAGCATGCTTTACACTTACTCTTTGTGCCACCACCACCTTCACCTGCAATGGGCGGT
GGATCGGATGCTCCAGCTCCAGTCCGAAATCCCTTCCCTTTCCAGCATAAACCAAACACGCTTGATCGAGACCGC
ATTGTAGTGCCTGTCGGATGGGACAGCTGGGGTAAAATATCCGTCTTGAGAGAGGGCTTTGATGCCAAGTTCTGG
GGCGAGGCTTGGGAAAATGATCTTGAGGAAGTAGAGGGACAAAGTAGTGGGGAAACAGGTGCCAAGAAGCTCTTC
ACAGTTTTAGTCCCGGACCAAGGCGAAAAGCCTCGCATTCTTCCACCCATCAACAATCCAATGCCAGAACAAACG
TTCCTTATGAAGCACTACGACGAAAACTCTAAGAAAGCCGATAGAGACCCTCGCGCTTCGTTCAGGAATCCGACG
GATCTAACCACTGGTGCTCCTGTGGGTATCGTTGGCCCTCTTGGAAGCAGCAGCTTCAGCATGCCCAATGTCGAA
CGTGTACTCAATGATATGGAGAACTCGACGATTGCGGCTTCGAATTCAGCCAATCAGGCTGCCGAAGCGCGCAAA
TTCCCTAATCGGCCCACGGGAAGGCCGGGTGGGATTGCGGGGCTCAATGCATCCACCAACGCGACACCATCTGCT
CGTACTCCCACATCGCCTCCCACGACGAGTCCTACTGGTGGACAACCAAGTCAACATGAAGTTTTGCAGCATTTC
TTCTGGAGCCTACTGAACTCCAAAGACCGTGCTGGAGGAAAAGATCCCAACGCGGCCAATACGTCGCCGCCAGCG
AAGACCAATGGGCAGACAGAAGAATAG
Transcript >AgabiH97|067670
ATGGATAATTCGCGTTCAACAACGCCGGAAGCACTACCCGAAAATCTCTGGTCATCTATCTTAGATTCTGTGTCG
ACATCCCGCTCTCTTCCCTCAAAACAAATCCTGCTTCTTGGACAACCCTCAACCGGAAAGTCGACAATCGCATCT
GCACTGCTACAGAGACCTGTATCTTCTGAAGAAAGTCAGGATGATAAGAGGGTGGACTTTGCCGTTGGTTATGAG
TTTGCTGACGTTAGGGACGACGGTGATGAAGATACTATAGCGCGGTTATCGGTCTATACCGTGCCGTCGTCAAAT
TCATCATATACAACATTGTTGCCACACTTTCTGCATCCAAGAACGGCACTAACACACTCGTTGGTGATGATCGTA
CTAGATTGGACGAGACCATGGTCGTTTGTGGAGGAACTACAGACTTGGTTACTATGGATTGAACGATGGGTCAAA
GGAGATGGTTCCAGAGAGCTTGAGATGGTGCGCGAAGAGTGCCGTGAGCGATTACAGTCATATCTGCAACATTAT
TCTGAGCCGTCTACTGATCTGCTGCCTGCATCTACCTCTGCATTGAGTAACACCGTCTTACCCCTTGGCCCAGGT
ACATTGACACACAATACTGCGGGCGTGCCAATAATTGTTGTGTGTAGCAAGGCAGATTTGATAGACGAAGAAAAT
GACGTGGTTGCTAGTGCTGCAGGTATGGGTGGCATGGTTAAAGGGAAGGGTGGTGAGTGGGAGGAGCGAACGGAC
GGAATCATGCAGGTTCTACGGACGATCTGCCTTAAGTATGGTGCATCACTATTCTACACGACCCCTCAACCCACC
ACTCTCCAGGTTCTGCGACAGCATGCTTTACACTTACTCTTTGTGCCACCACCACCTTCACCTGCAATGGGCGGT
GGATCGGATGCTCCAGCTCCAGTCCGAAATCCCTTCCCTTTCCAGCATAAACCAAACACGCTTGATCGAGACCGC
ATTGTAGTGCCTGTCGGATGGGACAGCTGGGGTAAAATATCCGTCTTGAGAGAGGGCTTTGATGCCAAGTTCTGG
GGCGAGGCTTGGGAAAATGATCTTGAGGAAGTAGAGGGACAAAGTAGTGGGGAAACAGGTGCCAAGAAGCTCTTC
ACAGTTTTAGTCCCGGACCAAGGCGAAAAGCCTCGCATTCTTCCACCCATCAACAATCCAATGCCAGAACAAACG
TTCCTTATGAAGCACTACGACGAAAACTCTAAGAAAGCCGATAGAGACCCTCGCGCTTCGTTCAGGAATCCGACG
GATCTAACCACTGGTGCTCCTGTGGGTATCGTTGGCCCTCTTGGAAGCAGCAGCTTCAGCATGCCCAATGTCGAA
CGTGTACTCAATGATATGGAGAACTCGACGATTGCGGCTTCGAATTCAGCCAATCAGGCTGCCGAAGCGCGCAAA
TTCCCTAATCGGCCCACGGGAAGGCCGGGTGGGATTGCGGGGCTCAATGCATCCACCAACGCGACACCATCTGCT
CGTACTCCCACATCGCCTCCCACGACGAGTCCTACTGGTGGACAACCAAGTCAACATGAAGTTTTGCAGCATTTC
TTCTGGAGCCTACTGAACTCCAAAGACCGTGCTGGAGGAAAAGATCCCAACGCGGCCAATACGTCGCCGCCAGCG
AAGACCAATGGGCAGACAGAAGAATAG
Gene >AgabiH97|067670
ATGGATAATTCGCGTTCAACAACGCCGGAAGCACTACCCGAAAATCTCTGGTCATCTATCTTAGATTCTGTGTCG
ACATCCCGCTCTCTTCCCTCAAAACAAATCCTGCTTCTTGGACAACCCTCAACCGGAAAGTCGACAATCGCATCT
GCACTGCTACAGAGACCTGTATCTTCTGAAGAAAGTCAGGATGATAAGAGGGTGGACTTTGCCGTTGGTTATGAG
TTTGCTGACGTTAGGGACGACGGTGATGAAGGTGCGTCGCGGCTGCACGATTGGGTCAGACGGGATTTTGCAGCT
CAAACATCAGTACAGATACTATAGCGCGGTTATCGGTCTATACCGTGCCGTCGTCAAATTCATCATATACAACAT
TGTTGCCACACTTTCTGCATCCAAGAACGGCACTAACACACTCGTTGGTGATGATCGTACTAGATTGGACGAGAC
CATGGTCGTTTGTGGAGGAACTACAGACTTGGTTACTATGGATTGAACGATGGGTCAAAGGAGATGGTTCCAGAG
AGCTTGAGATGGTGCGCGAAGAGTGCCGTGAGCGATGTAAGTACAAACGTAAAGGTGTCCTGTTACCGAGAAAGA
TTAATGAGGCCACAGTACAGTCATATCTGCAACATTATTCTGAGCCGTCTACTGATCTGCTGCCTGCATCTACCT
CTGCATTGAGTAACACCGTCTTACCCCTTGGCCCAGGTACATTGACACACAATACTGCGGGCGTGCCAATAATTG
TTGTGTGTAGCAAGGCAGATTTGATAGACGAAGAAAATGACGTGGTTGCTAGTGCTGCAGGTATGGGTGGCATGG
TTAAAGGGAAGGGTGGTGAGTGGGAGGAGCGAACGGACGGAATCATGCAGGTTCTACGGACGATCTGCCTTAAGT
GTAAGCAGCCCCTCTTTCGCACCCGAACGGCTACTGACTTTATGTTTACAGATGGTGCATCACTATTCTACACGA
CCCCTCAACCCACCACTCTCCAGGTTCTGCGACAGCATGCTTTACACTTACTCTTTGTGCCACCACCACCTTCAC
CTGCAATGGGCGGTGGATCGGATGCTCCAGCTCCAGTCCGAAATCCCTTCCCTTTCCAGCATAAACCAAACACGC
TTGATCGAGACCGCATTGTAGTGCCTGTCGGATGGGACAGCTGGGGTAAAATATCCGTCTTGAGAGAGGGCTTTG
ATGCCAAGTTCTGGGGCGAGGCTTGGGAAAATGATCTTGAGGAAGTAGAGGGACAAAGTAGTGGGGAAACAGGTG
CCAAGAAGCTCTTCACAGTTTTAGTCCCGGACCAAGGCGAAAAGGTACATTTTAAGAATTGTTTCTTTACTATTG
CTAAACGATGCCTCTGTGTAGCCTCGCATTCTTCCACCCATCAACAATCCAATGCCAGAACAAACGTTCCTTATG
AAGCACTACGACGAAAACTCTAAGAAAGCCGATAGAGACCCTCGCGCTTCGTTCAGGAATCCGACGGATCTAACC
ACTGGTGCTCCTGTGGGTATCGTTGGCCCTCTTGGAAGCAGCAGCTTCAGCATGCCCAATGTCGAACGTGTACTC
AATGATATGGAGAACTCGACGATTGCGGCTTCGAATTCAGCCAATCAGGCTGCCGAAGCGCGCAAATTCCCTAAT
CGGCCCACGGGAAGGCCGGGTGGGATTGCGGGGCTCAATGCATCCACCAACGCGACACCATCTGCTCGTACTCCC
ACATCGCCTCCCACGACGAGTCCTACTGGTGGACAACCAAGTCAACATGAAGTTTTGCAGCATTTCTTCTGGAGC
CTACTGAACTCCAAAGACCGTGCTGGAGGAAAAGATCCCAACGCGGCCAATACGTCGCCGCCAGCGAAGACCAAT
GGGCAGACAGAAGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail