Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|067300
Gene name
Locationscaffold_4:487355..488928
Strand+
Gene length (bp)1573
Transcript length (bp)1422
Coding sequence length (bp)1422
Protein length (aa) 474

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 1.3E-24 247 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 88 437 1.0E-50
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 24 436 2.0E-48
sp|Q9P2J9|PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens GN=PDP2 PE=2 SV=2 88 440 2.0E-34
sp|P35816|PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus GN=PDP1 PE=1 SV=1 88 448 6.0E-33
sp|O88483|PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus GN=Pdp1 PE=1 SV=1 88 448 8.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 88 437 1.0E-50
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 24 436 2.0E-48
sp|Q9P2J9|PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens GN=PDP2 PE=2 SV=2 88 440 2.0E-34
sp|P35816|PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus GN=PDP1 PE=1 SV=1 88 448 6.0E-33
sp|O88483|PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus GN=Pdp1 PE=1 SV=1 88 448 8.0E-33
sp|Q9P0J1|PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens GN=PDP1 PE=1 SV=3 88 448 1.0E-32
sp|Q5RA52|PDP1_PONAB [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Pongo abelii GN=PDP1 PE=2 SV=1 88 448 1.0E-32
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 88 448 1.0E-32
sp|O88484|PDP2_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Rattus norvegicus GN=Pdp2 PE=2 SV=1 88 440 1.0E-29
sp|Q9LUS8|P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana GN=At3g16560 PE=2 SV=1 70 436 7.0E-15
sp|Q7XVF9|P2C39_ORYSJ Probable protein phosphatase 2C 39 OS=Oryza sativa subsp. japonica GN=Os04g0403701 PE=2 SV=2 254 436 8.0E-12
sp|A3AZ89|P2C46_ORYSJ Putative protein phosphatase 2C 46 OS=Oryza sativa subsp. japonica GN=Os05g0111800 PE=3 SV=2 251 442 6.0E-11
sp|O82302|P2C29_ARATH Protein phosphatase 2C 29 OS=Arabidopsis thaliana GN=PLL1 PE=1 SV=2 209 435 1.0E-10
sp|Q9ZV25|P2C23_ARATH Probable protein phosphatase 2C 23 OS=Arabidopsis thaliana GN=PLL4 PE=2 SV=1 116 436 1.0E-09
sp|Q7Y138|P2C36_ORYSJ Probable protein phosphatase 2C 36 OS=Oryza sativa subsp. japonica GN=Os03g0832400 PE=2 SV=1 251 439 2.0E-09
sp|Q8RWN7|P2C32_ARATH Protein phosphatase 2C 32 OS=Arabidopsis thaliana GN=POL PE=1 SV=2 293 451 3.0E-09
sp|Q7XUC5|P2C43_ORYSJ Probable protein phosphatase 2C 43 OS=Oryza sativa subsp. japonica GN=Os04g0584300 PE=3 SV=2 250 436 5.0E-09
sp|Q6ZGY0|P2C26_ORYSJ Probable protein phosphatase 2C 26 OS=Oryza sativa subsp. japonica GN=Os02g0690500 PE=2 SV=1 251 452 7.0E-09
sp|Q84JD5|P2C68_ARATH Probable protein phosphatase 2C 68 OS=Arabidopsis thaliana GN=At5g06750 PE=2 SV=1 249 439 1.0E-08
sp|Q84T94|P2C35_ORYSJ Protein phosphatase 2C 35 OS=Oryza sativa subsp. japonica GN=XB15 PE=1 SV=1 251 436 1.0E-08
sp|Q9FKX4|P2C79_ARATH Probable protein phosphatase 2C 79 OS=Arabidopsis thaliana GN=At5g66080 PE=2 SV=1 251 439 2.0E-08
sp|Q7XCJ7|P2C72_ORYSJ Probable protein phosphatase 2C 72 OS=Oryza sativa subsp. japonica GN=Os10g0544900 PE=2 SV=1 247 436 2.0E-08
sp|Q9SD12|P2C46_ARATH Probable protein phosphatase 2C 46 OS=Arabidopsis thaliana GN=At3g51370 PE=2 SV=1 251 439 2.0E-08
sp|Q10S32|P2C28_ORYSJ Probable protein phosphatase 2C 28 OS=Oryza sativa subsp. japonica GN=Os03g0137200 PE=2 SV=1 247 436 3.0E-08
sp|Q501F9|P2C67_ARATH Probable protein phosphatase 2C 67 OS=Arabidopsis thaliana GN=At5g02760 PE=2 SV=1 254 436 4.0E-08
sp|Q0V7V2|P2C42_ARATH Probable protein phosphatase 2C 42 OS=Arabidopsis thaliana GN=At3g17090 PE=2 SV=1 251 439 5.0E-08
sp|Q6ZHC8|P2C25_ORYSJ Probable protein phosphatase 2C 25 OS=Oryza sativa subsp. japonica GN=Os02g0685600 PE=2 SV=1 245 436 1.0E-07
sp|Q7XHN8|P2C61_ORYSJ Probable protein phosphatase 2C 61 OS=Oryza sativa subsp. japonica GN=Os07g0114000 PE=2 SV=1 250 465 5.0E-07
sp|Q94CL8|P2C48_ARATH Probable protein phosphatase 2C 48 OS=Arabidopsis thaliana GN=PP2C6 PE=2 SV=1 254 436 6.0E-07
sp|Q8H063|P2C29_ORYSJ Probable protein phosphatase 2C 29 OS=Oryza sativa subsp. japonica GN=Os03g0207400 PE=2 SV=1 254 438 9.0E-07
sp|Q9LHJ9|P2C38_ARATH Probable protein phosphatase 2C 38 OS=Arabidopsis thaliana GN=At3g12620 PE=2 SV=1 254 436 9.0E-07
sp|Q5Z8P0|P2C60_ORYSJ Probable protein phosphatase 2C 60 OS=Oryza sativa subsp. japonica GN=Os06g0717800 PE=2 SV=1 251 436 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004721 phosphoprotein phosphatase activity No
GO:0042578 phosphoric ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|067300
MLRRVWKPVAATVVLGVPSYYVYRSYSRNPSFELSIRARGPDGKPEMSTRRIEILPLKTLEDRINQNTSVSSHTS
PEGIRWNHTTAFLASNDPIEDANATQIVHRDYSDPSAPGDYLFFTVMDGHSGTHTSQLLSKVLIKAVALELHSLS
NPSSKIDSSSGVLSSAKNLLWSPKRSTPSSSPSTPSHQGPVDADPARVSHAIAEAFARLDHELTSAPLRILANNL
DEESKKSRIVPDLSQHPLALTSMLPAISGSCAIMAMFDTAHRDLYVACTGDSRAVAGVWEPTEDGKGQWRVEVLS
EDQTGRNPNEAQRMRSEHPPEESGDVIRNGRVLGGLEPTRAFGDSRYKWPRPIQETLNEAFMKGNGRPIRPPPSL
FKTPPYVTARPVVTHRKFTFPSPNSPPTPSSEGSQKPTRFLVLATDGLWDELSNTEVVSLVAGHLQGLKGNVPKS
NLPSLVHTTIGTSCKGWQLGIQG*
Coding >AgabiH97|067300
ATGTTGCGGCGCGTATGGAAGCCTGTCGCTGCCACTGTCGTCCTCGGCGTCCCCTCATACTACGTTTACCGCTCC
TACTCGCGCAATCCATCTTTTGAGCTCTCCATTCGCGCCAGAGGGCCGGACGGCAAGCCGGAAATGAGCACGCGG
CGCATCGAGATTCTTCCCCTTAAGACTCTTGAGGATCGTATTAATCAGAATACCTCGGTTTCGTCTCATACAAGC
CCTGAAGGAATCAGATGGAATCATACTACTGCATTTCTGGCCTCCAATGACCCGATAGAGGACGCCAATGCTACC
CAAATTGTACATAGAGATTACTCTGACCCATCAGCTCCAGGCGACTACCTCTTCTTCACGGTCATGGACGGGCAT
AGTGGCACCCACACATCACAACTTCTTTCGAAAGTTCTCATTAAGGCTGTCGCCCTTGAGCTTCATTCACTCTCA
AACCCTTCATCCAAAATTGACTCCTCATCGGGCGTCCTCTCGAGTGCTAAGAATCTTCTCTGGAGCCCAAAACGT
TCTACCCCTTCTTCTTCTCCCTCCACACCATCCCATCAAGGGCCTGTAGATGCAGATCCTGCACGTGTCTCACAT
GCCATTGCGGAAGCCTTTGCACGTCTGGACCATGAACTCACCAGTGCTCCTCTCCGTATCCTCGCGAACAACTTG
GACGAAGAATCCAAAAAGAGCAGGATAGTCCCAGACTTGAGCCAACACCCGCTTGCACTCACTTCCATGCTTCCT
GCTATCTCTGGTAGCTGTGCCATCATGGCTATGTTTGACACCGCGCATCGCGATTTGTATGTTGCCTGTACAGGT
GACAGTCGAGCTGTTGCTGGCGTTTGGGAACCTACGGAAGATGGTAAGGGTCAATGGAGAGTTGAGGTACTGTCC
GAAGACCAGACAGGCCGAAACCCAAATGAAGCTCAGCGGATGCGTTCTGAACATCCACCGGAAGAATCTGGCGAT
GTCATTCGTAATGGGCGTGTCCTGGGAGGCCTTGAACCTACTCGAGCATTCGGTGACTCTCGCTACAAATGGCCT
CGACCAATCCAAGAAACCCTTAATGAAGCATTCATGAAGGGTAACGGCAGACCTATTCGCCCTCCACCTTCGCTT
TTCAAGACTCCACCATATGTGACCGCACGCCCCGTTGTTACCCATCGCAAATTCACTTTCCCCTCCCCCAATTCA
CCACCTACCCCATCATCAGAGGGTAGCCAGAAACCCACTCGTTTCCTCGTTCTAGCAACAGACGGTCTTTGGGAT
GAGCTCTCTAATACCGAAGTGGTGTCTCTCGTAGCAGGTCACCTCCAGGGCCTAAAGGGCAATGTCCCAAAATCC
AACCTCCCCTCCCTCGTACACACAACGATAGGAACGAGCTGCAAAGGCTGGCAATTGGGCATTCAAGGATGA
Transcript >AgabiH97|067300
ATGTTGCGGCGCGTATGGAAGCCTGTCGCTGCCACTGTCGTCCTCGGCGTCCCCTCATACTACGTTTACCGCTCC
TACTCGCGCAATCCATCTTTTGAGCTCTCCATTCGCGCCAGAGGGCCGGACGGCAAGCCGGAAATGAGCACGCGG
CGCATCGAGATTCTTCCCCTTAAGACTCTTGAGGATCGTATTAATCAGAATACCTCGGTTTCGTCTCATACAAGC
CCTGAAGGAATCAGATGGAATCATACTACTGCATTTCTGGCCTCCAATGACCCGATAGAGGACGCCAATGCTACC
CAAATTGTACATAGAGATTACTCTGACCCATCAGCTCCAGGCGACTACCTCTTCTTCACGGTCATGGACGGGCAT
AGTGGCACCCACACATCACAACTTCTTTCGAAAGTTCTCATTAAGGCTGTCGCCCTTGAGCTTCATTCACTCTCA
AACCCTTCATCCAAAATTGACTCCTCATCGGGCGTCCTCTCGAGTGCTAAGAATCTTCTCTGGAGCCCAAAACGT
TCTACCCCTTCTTCTTCTCCCTCCACACCATCCCATCAAGGGCCTGTAGATGCAGATCCTGCACGTGTCTCACAT
GCCATTGCGGAAGCCTTTGCACGTCTGGACCATGAACTCACCAGTGCTCCTCTCCGTATCCTCGCGAACAACTTG
GACGAAGAATCCAAAAAGAGCAGGATAGTCCCAGACTTGAGCCAACACCCGCTTGCACTCACTTCCATGCTTCCT
GCTATCTCTGGTAGCTGTGCCATCATGGCTATGTTTGACACCGCGCATCGCGATTTGTATGTTGCCTGTACAGGT
GACAGTCGAGCTGTTGCTGGCGTTTGGGAACCTACGGAAGATGGTAAGGGTCAATGGAGAGTTGAGGTACTGTCC
GAAGACCAGACAGGCCGAAACCCAAATGAAGCTCAGCGGATGCGTTCTGAACATCCACCGGAAGAATCTGGCGAT
GTCATTCGTAATGGGCGTGTCCTGGGAGGCCTTGAACCTACTCGAGCATTCGGTGACTCTCGCTACAAATGGCCT
CGACCAATCCAAGAAACCCTTAATGAAGCATTCATGAAGGGTAACGGCAGACCTATTCGCCCTCCACCTTCGCTT
TTCAAGACTCCACCATATGTGACCGCACGCCCCGTTGTTACCCATCGCAAATTCACTTTCCCCTCCCCCAATTCA
CCACCTACCCCATCATCAGAGGGTAGCCAGAAACCCACTCGTTTCCTCGTTCTAGCAACAGACGGTCTTTGGGAT
GAGCTCTCTAATACCGAAGTGGTGTCTCTCGTAGCAGGTCACCTCCAGGGCCTAAAGGGCAATGTCCCAAAATCC
AACCTCCCCTCCCTCGTACACACAACGATAGGAACGAGCTGCAAAGGCTGGCAATTGGGCATTCAAGGATGA
Gene >AgabiH97|067300
ATGTTGCGGCGCGTATGGAAGCCTGTCGCTGCCACTGTCGTCCTCGGCGTCCCCTCATACTACGTTTACCGCTCC
TACTCGCGCAATCCATCTTTTGAGCTCTCCATTCGCGCCAGAGGGCCGGACGGCAAGCCGGAAATGAGCACGCGG
CGCATCGAGATTCTTCCCCTTAAGACTCTTGAGGATCGTATTAATCAGAATACCTCGGTTTCGTCTCATACAAGC
CCTGAAGGAATCAGATGGAATCATACTACTGCATTTCTGGCCTCCAATGACCCGATAGAGGACGCCAATGCTACC
CAAATTGTACATAGAGATTACTCTGACCCATCAGCTCCAGGCGACTACCTCTTCTTCACGGTCATGGACGGGCAT
AGTGGCACCCACACATCACAACTTCTTTCGAAAGTTCTCATTAAGGCTGTCGCCCTTGAGCTTCATTCACTCTCA
AACCCTTCATCCAAAATTGACTCCTCATCGGGCGTCCTCTCGAGTGCTAAGAATCTTCTCTGGAGCCCAAAACGT
TCTACCCCTTCTTCTTCTCCCTCCACACCATCCCATCAAGGGCCTGTAGATGCAGATCCTGCACGTGTCTCACAT
GCCATTGCGGAAGCCTTTGCACGTCTGGACCATGAACTCACCAGTGCTCCTCTCCGTATCCTCGCGAACAACTTG
GACGAAGAATCCAAAAAGAGCAGGATAGTCCCAGACTTGAGCCAACACCCGCTTGCACTCACTTCCATGCTTCCT
GCTATCTCTGGTAGCTGTGCCATCATGGCTATGTTTGACACCGCGCATCGCGATTTGTATGTTGCCTGTACAGGT
GACAGTCGAGCTGTTGCTGGCGTTTGGGAACCTACGGAAGATGGTAAGGGTCAATGGAGAGTTGAGGTACTGTCC
GAAGACCAGACAGGCCGAAACCCAAATGAAGCTCAGCGGTAAGCTTCTACCACCTTTTGATTTTGCGTATCCTCG
TTAATTGCCCTTCCGCAGGATGCGTTCTGAACATCCACCGGAAGAATCTGGCGATGTCATTCGTAATGGGCGTGT
CCTGGGAGGCCTTGAACCTACTCGAGCATTCGGTGACTCTCGCTACAAATGGCCTCGACCAATCCAAGAAACGTA
AGTCCTGACAGAGTACTTCCTTTCCCAGCTGATGATTTTATAGCCTTAATGAAGCATTCATGAAGGGTAACGGCA
GACCTATTCGCCCTCCACCTTCGCTTTTCAAGACTCCACCATATGTGACCGCACGCCCCGTTGTTACCCATCGCA
AATTCACTTTCCCCTCCCCCAATTCACCACCTACCCCATCATCAGAGGGTAGCCAGAAACCCACTCGTTTCCTCG
TTCTAGCAACAGACGGTCTTTGGGATGAGCTCTCTAATACCGAAGTGGTGTCTCTCGTAGCAGGTCACCTCCAGG
GCCTAAAGGGCAATGTCCCAAAATCCAACCTCCCCTCCCTCGTACACACAACGATAGGTGAAGCTTCTGGTATCG
ATGGAAAATCAGTCTCGACTCAAGAACACAAGGAACGAGCTGCAAAGGCTGGCAATTGGGCATTCAAGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail