Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|067240
Gene name
Locationscaffold_4:470733..471635
Strand+
Gene length (bp)902
Transcript length (bp)597
Coding sequence length (bp)597
Protein length (aa) 199

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00188 CAP Cysteine-rich secretory protein family 3.5E-18 59 177

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AB49|Y6200_CANAL Probable pathogenesis-related protein CaO19.6200 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13580 PE=2 SV=1 58 191 7.0E-18
sp|Q41495|ST14_SOLTU STS14 protein OS=Solanum tuberosum GN=STS14 PE=2 SV=1 57 185 1.0E-17
sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1 OS=Medicago truncatula GN=PR-1 PE=2 SV=1 49 185 6.0E-17
sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS OS=Zea mays GN=PRMS PE=2 SV=1 57 185 2.0E-16
sp|Q9ZNS4|PRB1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1 57 182 4.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AB49|Y6200_CANAL Probable pathogenesis-related protein CaO19.6200 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13580 PE=2 SV=1 58 191 7.0E-18
sp|Q41495|ST14_SOLTU STS14 protein OS=Solanum tuberosum GN=STS14 PE=2 SV=1 57 185 1.0E-17
sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1 OS=Medicago truncatula GN=PR-1 PE=2 SV=1 49 185 6.0E-17
sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS OS=Zea mays GN=PRMS PE=2 SV=1 57 185 2.0E-16
sp|Q9ZNS4|PRB1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1 57 182 4.0E-16
sp|P35795|SC14_SCHCO Fruiting body protein SC14 OS=Schizophyllum commune GN=SC14 PE=2 SV=1 50 184 8.0E-16
sp|P35794|SC7_SCHCO Fruiting body protein SC7 OS=Schizophyllum commune GN=SC7 PE=2 SV=1 41 183 2.0E-15
sp|P33154|PR1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=At2g14610 PE=1 SV=1 57 184 3.0E-15
sp|P09042|PR1C_TOBAC Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3 57 185 5.0E-15
sp|P07053|PR1B_TOBAC Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1 57 185 5.0E-15
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 58 185 5.0E-15
sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 57 185 2.0E-14
sp|P08299|PR1A_TOBAC Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1 57 185 2.0E-14
sp|D4B327|PRY1_ARTBC Probable pathogenesis-related protein ARB_02861 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02861 PE=3 SV=2 61 191 2.0E-14
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 58 191 5.0E-14
sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1 57 185 8.0E-14
sp|Q3SB04|CRVP_NOTSC Cysteine-rich venom protein pseudechetoxin-like OS=Notechis scutatus scutatus PE=2 SV=1 58 187 2.0E-13
sp|F8J2D4|CRVP_DRYCN Cysteine-rich venom protein OS=Drysdalia coronoides PE=1 SV=1 58 187 2.0E-13
sp|Q08697|PR1A_SOLLC Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1 57 191 2.0E-13
sp|Q8AVA3|CRVP_PSEPO Cysteine-rich venom protein pseudecin OS=Pseudechis porphyriacus PE=1 SV=1 58 187 3.0E-13
sp|Q7ZT98|CRVP_OPHHA Cysteine-rich venom protein ophanin OS=Ophiophagus hannah PE=1 SV=1 38 185 3.0E-13
sp|A8S6B6|CRVP_AUSSU Cysteine-rich venom protein OS=Austrelaps superbus PE=2 SV=1 58 187 3.0E-13
sp|P0CB15|CRIS_PROFL Serotriflin OS=Protobothrops flavoviridis PE=1 SV=1 58 187 4.0E-13
sp|Q3SB03|CRVP_HOPST Cysteine-rich venom protein pseudechetoxin-like OS=Hoplocephalus stephensii PE=2 SV=1 58 187 4.0E-13
sp|Q8JI38|CRVP_LATSE Cysteine-rich venom protein latisemin OS=Laticauda semifasciata PE=2 SV=1 58 187 6.0E-13
sp|Q3SB07|CRVP_OXYSC Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 58 187 7.0E-13
sp|Q3SB06|CRVP_OXYMI Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus microlepidotus PE=2 SV=1 58 187 8.0E-13
sp|Q41359|PR1_SAMNI Pathogenesis-related protein PR-1 type OS=Sambucus nigra PE=2 SV=1 57 185 1.0E-12
sp|Q04108|PR04_SOLLC Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum PE=2 SV=1 57 185 2.0E-12
sp|Q3SB05|CRVP_PSETE Cysteine-rich venom protein pseudechetoxin-like OS=Pseudonaja textilis PE=1 SV=1 58 187 2.0E-12
sp|Q8AVA4|CRVP_PSEAU Cysteine-rich venom protein pseudechetoxin OS=Pseudechis australis PE=1 SV=1 58 187 2.0E-12
sp|Q09GJ9|CRVP_PHIOL Cysteine-rich venom protein OS=Philodryas olfersii PE=2 SV=1 49 185 2.0E-12
sp|P84808|CRVP2_NAJKA Cysteine-rich venom protein kaouthin-2 OS=Naja kaouthia PE=1 SV=2 7 187 3.0E-12
sp|Q7ZZN8|CRVP2_NAJAT Cysteine-rich venom protein natrin-2 OS=Naja atra PE=1 SV=1 7 187 3.0E-12
sp|Q2XXP4|CRVP_TRIBI Cysteine-rich venom protein TRI1 (Fragment) OS=Trimorphodon biscutatus PE=2 SV=1 38 185 4.0E-12
sp|Q59WG5|Y2336_CANAL Probable pathogenesis-related protein CaO19.2336 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.2336 PE=2 SV=1 58 191 4.0E-12
sp|Q2XXQ3|CRVP1_PSEPL Cysteine-rich venom protein ENH1 OS=Pseudoferania polylepis PE=2 SV=1 34 185 1.0E-11
sp|Q2XXQ2|CRVP2_PSEPL Cysteine-rich venom protein ENH2 OS=Pseudoferania polylepis PE=2 SV=1 34 185 1.0E-11
sp|P04284|PR06_SOLLC Pathogenesis-related leaf protein 6 OS=Solanum lycopersicum GN=PR1B1 PE=1 SV=2 57 185 1.0E-11
sp|Q2XXQ1|CRVP_LEIMD Cysteine-rich venom protein LEI1 (Fragment) OS=Leioheterodon madagascariensis PE=1 SV=1 34 185 1.0E-11
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 58 191 1.0E-11
sp|Q8JI39|CRVP_PROFL Cysteine-rich venom protein triflin OS=Protobothrops flavoviridis PE=1 SV=1 34 185 1.0E-11
sp|Q8JGT9|CRVP_RHATT Cysteine-rich venom protein tigrin OS=Rhabdophis tigrinus tigrinus PE=1 SV=1 34 185 2.0E-11
sp|B7FDI1|CRVP_VIPBE Cysteine-rich venom protein OS=Vipera berus PE=1 SV=1 34 185 2.0E-11
sp|P11670|PRB1_TOBAC Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1 57 185 2.0E-11
sp|D8VNS1|CRVP_CERRY Cysteine-rich venom protein OS=Cerberus rynchops PE=1 SV=1 9 185 2.0E-11
sp|P84805|CRVP1_NAJKA Cysteine-rich venom protein kaouthin-1 OS=Naja kaouthia PE=1 SV=2 34 185 3.0E-11
sp|A6MFK9|CRVP_DEMVE Cysteine-rich venom protein OS=Demansia vestigiata PE=2 SV=1 58 185 4.0E-11
sp|B7FDI0|CRVP_VIPNI Cysteine-rich venom protein (Fragment) OS=Vipera nikolskii PE=2 SV=1 38 185 6.0E-11
sp|Q7T141|PI15A_DANRE Peptidase inhibitor 15-A OS=Danio rerio GN=pi15a PE=3 SV=2 40 185 6.0E-11
sp|Q8UW11|CRVP2_HYDHA Cysteine-rich venom protein 2 OS=Hydrophis hardwickii PE=2 SV=2 58 183 7.0E-11
sp|P16562|CRIS2_HUMAN Cysteine-rich secretory protein 2 OS=Homo sapiens GN=CRISP2 PE=1 SV=1 61 192 7.0E-11
sp|Q2XXP5|CRVP_TELDH Cysteine-rich venom protein TEL1 (Fragment) OS=Telescopus dhara PE=2 SV=1 38 185 8.0E-11
sp|Q7ZZN9|CRVP_PROJR Cysteine-rich venom protein OS=Protobothrops jerdonii PE=1 SV=1 34 185 9.0E-11
sp|P0DMT4|CRVP_ECHCO Cysteine-rich venom protein OS=Echis coloratus PE=1 SV=1 49 185 9.0E-11
sp|Q3KPV7|PI15_XENLA Peptidase inhibitor 15 OS=Xenopus laevis GN=pi15 PE=2 SV=1 7 185 1.0E-10
sp|Q09566|LON1_CAEEL Protein lon-1 OS=Caenorhabditis elegans GN=lon-1 PE=1 SV=1 39 184 1.0E-10
sp|Q05108|VA5_DOLAR Venom allergen 5 OS=Dolichovespula arenaria PE=1 SV=1 67 156 1.0E-10
sp|Q7T1K6|CRVP1_NAJAT Cysteine-rich venom protein natrin-1 OS=Naja atra PE=1 SV=1 38 185 1.0E-10
sp|P35793|PR13_HORVU Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1 41 185 1.0E-10
sp|Q6UWM5|GPRL1_HUMAN GLIPR1-like protein 1 OS=Homo sapiens GN=GLIPR1L1 PE=1 SV=2 51 182 2.0E-10
sp|Q2XXQ5|CRVP2_DISTY Cysteine-rich venom protein DIS2 OS=Dispholidus typus PE=2 SV=1 49 185 3.0E-10
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 61 191 3.0E-10
sp|P60623|CRVP_TRIST Cysteine-rich venom protein (Fragment) OS=Trimeresurus stejnegeri PE=1 SV=1 34 185 3.0E-10
sp|A9YME1|VA5_MICHY Venom allergen 5 OS=Microctonus hyperodae PE=2 SV=1 59 186 3.0E-10
sp|Q4V9Y5|CRLD2_XENTR Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1 58 185 4.0E-10
sp|Q9CWG1|GLIP1_MOUSE Glioma pathogenesis-related protein 1 OS=Mus musculus GN=Glipr1 PE=2 SV=1 54 182 7.0E-10
sp|Q59PV6|PRY1_CANAL Secreted protein PRY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRY1 PE=1 SV=1 58 191 8.0E-10
sp|Q7ZTA0|CRVP_AGKPI Cysteine-rich venom protein piscivorin OS=Agkistrodon piscivorus piscivorus PE=1 SV=1 34 187 8.0E-10
sp|O43692|PI15_HUMAN Peptidase inhibitor 15 OS=Homo sapiens GN=PI15 PE=1 SV=1 32 185 1.0E-09
sp|Q2XXQ4|CRVP3_DISTY Cysteine-rich venom protein DIS3 OS=Dispholidus typus PE=2 SV=1 49 185 1.0E-09
sp|Q8BS03|PI15_MOUSE Peptidase inhibitor 15 OS=Mus musculus GN=Pi15 PE=2 SV=2 41 185 1.0E-09
sp|Q98ST6|PI15_CHICK Peptidase inhibitor 15 OS=Gallus gallus GN=PI15 PE=2 SV=1 4 185 1.0E-09
sp|Q58D34|PI16_BOVIN Peptidase inhibitor 16 OS=Bos taurus GN=PI16 PE=2 SV=1 58 185 2.0E-09
sp|Q2XXQ6|CRVP1_DISTY Cysteine-rich venom protein DIS1 OS=Dispholidus typus PE=2 SV=1 49 185 2.0E-09
sp|A2A5I3|CRSPL_MOUSE Peptidase inhibitor R3HDML OS=Mus musculus GN=R3hdml PE=3 SV=1 54 185 2.0E-09
sp|Q9ET66|PI16_MOUSE Peptidase inhibitor 16 OS=Mus musculus GN=Pi16 PE=2 SV=1 61 185 2.0E-09
sp|P10737|VA53_DOLMA Venom allergen 5.02 (Fragment) OS=Dolichovespula maculata PE=1 SV=3 67 156 2.0E-09
sp|P35787|VA5_VESVI Venom allergen 5 OS=Vespula vidua PE=1 SV=1 67 182 2.0E-09
sp|P35778|VA3_SOLIN Venom allergen 3 OS=Solenopsis invicta PE=1 SV=2 64 186 3.0E-09
sp|Q2XXQ0|CRVP_ERYPO Cysteine-rich venom protein LIO1 (Fragment) OS=Erythrolamprus poecilogyrus PE=2 SV=1 38 185 3.0E-09
sp|P35786|VA5_VESSQ Venom allergen 5 OS=Vespula squamosa PE=1 SV=1 67 182 3.0E-09
sp|Q5AB48|RBT4_CANAL Secreted protein RBT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBT4 PE=1 SV=2 58 185 3.0E-09
sp|Q8UW25|CRVP1_HYDHA Cysteine-rich venom protein 1 OS=Hydrophis hardwickii PE=2 SV=2 58 183 4.0E-09
sp|Q7ZT99|CRVP_CROAT Cysteine-rich venom protein catrin OS=Crotalus atrox PE=1 SV=1 34 185 4.0E-09
sp|Q60477|CRIS2_CAVPO Cysteine-rich secretory protein 2 OS=Cavia porcellus GN=CRISP2 PE=1 SV=1 58 184 4.0E-09
sp|P79845|CRVP_PROMU Cysteine-rich venom protein OS=Protobothrops mucrosquamatus PE=2 SV=2 35 185 4.0E-09
sp|Q32LB5|GPRL1_BOVIN GLIPR1-like protein 1 OS=Bos taurus GN=GLIPR1L1 PE=2 SV=1 62 182 5.0E-09
sp|P35779|VA3_SOLRI Venom allergen 3 OS=Solenopsis richteri PE=1 SV=2 64 185 6.0E-09
sp|Q6UXB8|PI16_HUMAN Peptidase inhibitor 16 OS=Homo sapiens GN=PI16 PE=1 SV=1 58 185 1.0E-08
sp|F8S0Y4|CRVP_CROAD Cysteine-rich secretory protein OS=Crotalus adamanteus PE=1 SV=1 34 185 1.0E-08
sp|P54108|CRIS3_HUMAN Cysteine-rich secretory protein 3 OS=Homo sapiens GN=CRISP3 PE=1 SV=1 58 182 1.0E-08
sp|P48060|GLIP1_HUMAN Glioma pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR1 PE=1 SV=3 61 182 1.0E-08
sp|Q03401|CRIS1_MOUSE Cysteine-rich secretory protein 1 OS=Mus musculus GN=Crisp1 PE=2 SV=1 9 187 2.0E-08
sp|O19010|CRIS3_HORSE Cysteine-rich secretory protein 3 OS=Equus caballus GN=CRISP3 PE=1 SV=1 67 187 2.0E-08
sp|B3EWZ8|ECT_ACRMI Ectin (Fragment) OS=Acropora millepora PE=1 SV=1 21 191 2.0E-08
sp|Q9H3Y0|CRSPL_HUMAN Peptidase inhibitor R3HDML OS=Homo sapiens GN=R3HDML PE=2 SV=1 56 185 2.0E-08
sp|Q98ST5|CRLD1_CHICK Cysteine-rich secretory protein LCCL domain-containing 1 OS=Gallus gallus GN=CRISPLD1 PE=2 SV=1 52 185 2.0E-08
sp|Q9H336|CRLD1_HUMAN Cysteine-rich secretory protein LCCL domain-containing 1 OS=Homo sapiens GN=CRISPLD1 PE=2 SV=1 54 185 5.0E-08
sp|Q91055|CRVP_HELHO Cysteine-rich venom protein helothermine OS=Heloderma horridum horridum PE=1 SV=1 50 183 7.0E-08
sp|P86686|VA5_POLPI Venom allergen 5 OS=Polybia paulista PE=1 SV=1 66 187 1.0E-07
sp|Q8CGD2|CRLD1_MOUSE Cysteine-rich secretory protein LCCL domain-containing 1 OS=Mus musculus GN=Crispld1 PE=2 SV=1 12 185 1.0E-07
sp|B0VXV6|CRVP_SISCA Cysteine-rich venom protein 2 OS=Sistrurus catenatus edwardsii PE=2 SV=1 34 185 1.0E-07
sp|P35782|VA52_VESCR Venom allergen 5.02 OS=Vespa crabro PE=1 SV=1 67 183 2.0E-07
sp|Q7Z156|VA5_POLSR Venom allergen 5 OS=Polybia scutellaris rioplatensis PE=1 SV=2 66 185 4.0E-07
sp|P35781|VA51_VESCR Venom allergen 5.01 OS=Vespa crabro PE=1 SV=1 67 183 6.0E-07
sp|Q9CYL5|GAPR1_MOUSE Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus GN=Glipr2 PE=1 SV=3 58 192 6.0E-07
sp|Q9H0B8|CRLD2_HUMAN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Homo sapiens GN=CRISPLD2 PE=2 SV=1 61 185 1.0E-06
sp|Q8BZQ2|CRLD2_MOUSE Cysteine-rich secretory protein LCCL domain-containing 2 OS=Mus musculus GN=Crispld2 PE=1 SV=1 61 185 2.0E-06
sp|Q9H4G4|GAPR1_HUMAN Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR2 PE=1 SV=3 58 184 2.0E-06
sp|P86870|VA5_VESMG Venom allergen 5 OS=Vespa magnifica PE=1 SV=2 67 183 3.0E-06
sp|Q2XXP2|CRVPA_VARVA Cysteine-rich venom protein VAR10 (Fragment) OS=Varanus varius PE=2 SV=1 38 185 3.0E-06
sp|P35785|VA5_VESPE Venom allergen 5 OS=Vespula pensylvanica PE=1 SV=1 67 156 4.0E-06
sp|A6QLZ7|CRLD2_BOVIN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Bos taurus GN=CRISPLD2 PE=2 SV=1 25 185 4.0E-06
sp|P81656|VA5_POLDO Venom allergen 5 OS=Polistes dominula PE=1 SV=2 66 185 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|067240
MFTLHLFSIFTLLITALLHPTRAINTSHHTRHARRHAGHASMDATAVRRSPAHIAAYLEGHNVVRAAHGVKPLRW
SPHFANLAEQWADACNFKHTDGVLSDKPYGENIVAATGPFSVHAAMGTFIEDAADFNPHHPHFTHYTQVLWESTT
ELGCASSVCKDLLGPSTGPATLYVCLYNPPGNVVGGMRQNLPSVFHHS*
Coding >AgabiH97|067240
ATGTTTACGCTCCACCTCTTTTCCATTTTCACTCTCCTGATAACCGCCCTGCTCCACCCGACTCGCGCTATCAAC
ACATCGCATCACACTCGCCACGCACGCCGCCACGCAGGACATGCTTCCATGGATGCTACCGCGGTCCGTCGTTCA
CCAGCTCACATCGCGGCCTACCTCGAAGGACACAACGTCGTTCGCGCAGCCCATGGCGTCAAACCCCTTCGATGG
TCACCCCATTTCGCCAATTTGGCCGAACAATGGGCCGATGCGTGTAATTTCAAGCACACAGATGGTGTACTGAGC
GATAAACCTTACGGAGAAAATATCGTTGCTGCTACTGGTCCATTCTCTGTCCACGCCGCAATGGGTACTTTCATA
GAAGATGCTGCCGACTTCAATCCACACCACCCTCACTTCACCCATTATACTCAAGTCTTATGGGAATCAACCACC
GAACTCGGTTGTGCCTCTTCTGTCTGTAAGGACCTCCTGGGTCCTTCGACAGGTCCTGCTACTTTGTATGTTTGT
CTCTACAACCCTCCCGGAAATGTCGTTGGCGGAATGAGGCAAAACCTGCCATCAGTTTTCCACCATTCTTAG
Transcript >AgabiH97|067240
ATGTTTACGCTCCACCTCTTTTCCATTTTCACTCTCCTGATAACCGCCCTGCTCCACCCGACTCGCGCTATCAAC
ACATCGCATCACACTCGCCACGCACGCCGCCACGCAGGACATGCTTCCATGGATGCTACCGCGGTCCGTCGTTCA
CCAGCTCACATCGCGGCCTACCTCGAAGGACACAACGTCGTTCGCGCAGCCCATGGCGTCAAACCCCTTCGATGG
TCACCCCATTTCGCCAATTTGGCCGAACAATGGGCCGATGCGTGTAATTTCAAGCACACAGATGGTGTACTGAGC
GATAAACCTTACGGAGAAAATATCGTTGCTGCTACTGGTCCATTCTCTGTCCACGCCGCAATGGGTACTTTCATA
GAAGATGCTGCCGACTTCAATCCACACCACCCTCACTTCACCCATTATACTCAAGTCTTATGGGAATCAACCACC
GAACTCGGTTGTGCCTCTTCTGTCTGTAAGGACCTCCTGGGTCCTTCGACAGGTCCTGCTACTTTGTATGTTTGT
CTCTACAACCCTCCCGGAAATGTCGTTGGCGGAATGAGGCAAAACCTGCCATCAGTTTTCCACCATTCTTAG
Gene >AgabiH97|067240
ATGTTTACGCTCCACCTCTTTTCCATTTTCACTCTCCTGATAACCGCCCTGCTCCACCCGACTCGCGCTATCAAC
ACATCGCATCACACTCGCCACGCACGCCGCCACGCAGGACATGCTTCCATGGATGCTACCGCGGTCCGTCGTTCA
CCAGCTCACATCGCGGCCTACCTCGAAGGACACAACGTCGTTCGCGCAGCCCATGGCGTCAAACCCCTTCGATGG
TCACCCCATTTCGCCAATTTGGCCGAACAATGGGCCGATGCGTGTAATTTCAAGCACACAGATGGTGTACTGAGC
GATAAACCTTACGGAGAAAATATCGTTGCTGCTACTGGTCCATTCTCTGTCCACGCCGCAATGGGTACTTTCATA
GAAGATGCTGGTAAGCGTGCTTTTCATGTATGACTTTCAATTTTCCGTCCAGCTGTAGTCTGCATGTTGCATGTT
GTTCCTGATTCCAGGGGAATTGATTTGACATCTCGTTCCTGGGCGTCTTTTTTTGTAACCTTATTTTTGACTTGA
CGTGATGGGCATGTACATGTCCTCGCCACCTCCGTCCGCGTTTTTGCATTTTCTCTGTGGGGTTGATGTATTCAT
AGCAACTTTACTGATCAATTGATTGTCCTATTAGCCGACTTCAATCCACACCACCCTCACTTCACCCATTATACT
CAAGTCTTATGGGAATCAACCACCGAACTCGGTTGTGCCTCTTCTGTCTGTAAGGACCTCCTGGGTCCTTCGACA
GGTCCTGCTACTTTGTATGTTTGTCTCTACAACCCTCCCGGAAATGTCGTTGGCGGAATGAGGTGAGTTTGTCTC
CTGGGTTGGGATTGATCCGCTGAAACATAAATTTTCTACCCAGGCAAAACCTGCCATCAGTTTTCCACCATTCTT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail