Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|067100
Gene name
Locationscaffold_4:432788..435211
Strand-
Gene length (bp)2423
Transcript length (bp)2046
Coding sequence length (bp)2046
Protein length (aa) 682

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain 7.9E-24 587 679
PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain) 3.6E-19 55 140
PF00128 Alpha-amylase Alpha amylase, catalytic domain 3.8E-11 207 278

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CN82|GLGB_CRYNJ 1,4-alpha-glucan-branching enzyme OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GLC3 PE=3 SV=1 7 679 0.0E+00
sp|P0CN83|GLGB_CRYNB 1,4-alpha-glucan-branching enzyme OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GLC3 PE=3 SV=1 7 679 0.0E+00
sp|Q8NKE1|GLGB_RHIID 1,4-alpha-glucan-branching enzyme OS=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) GN=GLC3 PE=2 SV=2 11 678 0.0E+00
sp|Q96VA4|GLGB_ASPOR 1,4-alpha-glucan-branching enzyme OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gbeA PE=2 SV=1 3 679 0.0E+00
sp|Q9Y8H3|GLGB_EMENI 1,4-alpha-glucan-branching enzyme OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=be1 PE=2 SV=3 3 679 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CN82|GLGB_CRYNJ 1,4-alpha-glucan-branching enzyme OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GLC3 PE=3 SV=1 7 679 0.0E+00
sp|P0CN83|GLGB_CRYNB 1,4-alpha-glucan-branching enzyme OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GLC3 PE=3 SV=1 7 679 0.0E+00
sp|Q8NKE1|GLGB_RHIID 1,4-alpha-glucan-branching enzyme OS=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) GN=GLC3 PE=2 SV=2 11 678 0.0E+00
sp|Q96VA4|GLGB_ASPOR 1,4-alpha-glucan-branching enzyme OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gbeA PE=2 SV=1 3 679 0.0E+00
sp|Q9Y8H3|GLGB_EMENI 1,4-alpha-glucan-branching enzyme OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=be1 PE=2 SV=3 3 679 0.0E+00
sp|Q6CCT1|GLGB_YARLI 1,4-alpha-glucan-branching enzyme OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLC3 PE=3 SV=1 10 681 0.0E+00
sp|Q6FJV0|GLGB_CANGA 1,4-alpha-glucan-branching enzyme OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLC3 PE=3 SV=1 5 681 0.0E+00
sp|Q6EAS5|GLGB_HORSE 1,4-alpha-glucan-branching enzyme OS=Equus caballus GN=GBE1 PE=2 SV=1 7 678 0.0E+00
sp|Q6T308|GLGB_FELCA 1,4-alpha-glucan-branching enzyme OS=Felis catus GN=GBE1 PE=2 SV=1 9 678 0.0E+00
sp|Q6CX53|GLGB_KLULA 1,4-alpha-glucan-branching enzyme OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLC3 PE=3 SV=1 5 679 0.0E+00
sp|Q9D6Y9|GLGB_MOUSE 1,4-alpha-glucan-branching enzyme OS=Mus musculus GN=Gbe1 PE=1 SV=1 9 678 0.0E+00
sp|P32775|GLGB_YEAST 1,4-alpha-glucan-branching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC3 PE=1 SV=2 5 681 0.0E+00
sp|Q04446|GLGB_HUMAN 1,4-alpha-glucan-branching enzyme OS=Homo sapiens GN=GBE1 PE=1 SV=3 9 678 0.0E+00
sp|Q6BXN1|GLGB_DEBHA 1,4-alpha-glucan-branching enzyme OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLC3 PE=3 SV=1 11 681 0.0E+00
sp|Q757Q6|GLGB_ASHGO 1,4-alpha-glucan-branching enzyme OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLC3 PE=3 SV=1 1 680 0.0E+00
sp|Q555Q9|GLGB_DICDI 1,4-alpha-glucan-branching enzyme OS=Dictyostelium discoideum GN=glgB PE=3 SV=1 7 680 0.0E+00
sp|Q01401|GLGB_ORYSJ 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic OS=Oryza sativa subsp. japonica GN=SBE1 PE=1 SV=2 6 677 0.0E+00
sp|Q9LZS3|GLGB2_ARATH 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=SBE2.2 PE=2 SV=1 4 677 0.0E+00
sp|O23647|GLGB1_ARATH 1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=SBE2.1 PE=2 SV=1 4 674 0.0E+00
sp|Q41058|GLGB1_PEA 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic OS=Pisum sativum GN=SBEI PE=1 SV=1 4 677 0.0E+00
sp|Q08047|GLGB_MAIZE 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic OS=Zea mays GN=SBE1 PE=1 SV=1 4 677 0.0E+00
sp|P30924|GLGB_SOLTU 1,4-alpha-glucan-branching enzyme OS=Solanum tuberosum GN=SBE1 PE=2 SV=2 11 677 0.0E+00
sp|Q41059|GLGB2_PEA 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic (Fragment) OS=Pisum sativum GN=SBEII PE=1 SV=1 11 677 0.0E+00
sp|D2WL32|GLGB3_ARATH 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=SBE3 PE=1 SV=1 115 677 8.0E-149
sp|Q24VW3|GLGB_DESHY 1,4-alpha-glucan branching enzyme GlgB OS=Desulfitobacterium hafniense (strain Y51) GN=glgB PE=3 SV=1 49 678 4.0E-64
sp|Q8CZE8|GLGB_OCEIH 1,4-alpha-glucan branching enzyme GlgB OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glgB PE=3 SV=1 71 678 3.0E-63
sp|B8CVY1|GLGB_HALOH 1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=glgB PE=3 SV=1 42 678 2.0E-58
sp|Q8RF62|GLGB_FUSNN 1,4-alpha-glucan branching enzyme GlgB OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=glgB PE=3 SV=1 39 681 3.0E-58
sp|Q21M30|GLGB_SACD2 1,4-alpha-glucan branching enzyme GlgB OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=glgB PE=3 SV=1 45 678 3.0E-55
sp|Q2IYX0|GLGB_RHOP2 1,4-alpha-glucan branching enzyme GlgB OS=Rhodopseudomonas palustris (strain HaA2) GN=glgB PE=3 SV=1 51 642 1.0E-54
sp|Q31IB6|GLGB_THICR 1,4-alpha-glucan branching enzyme GlgB OS=Thiomicrospira crunogena (strain XCL-2) GN=glgB PE=3 SV=1 66 681 3.0E-54
sp|Q5N4W5|GLGB_SYNP6 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=glgB PE=3 SV=1 51 678 1.0E-53
sp|P16954|GLGB_SYNE7 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus elongatus (strain PCC 7942) GN=glgB PE=1 SV=2 51 678 1.0E-53
sp|A9BAY7|GLGB_PROM4 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9211) GN=glgB PE=3 SV=1 27 678 1.0E-53
sp|Q15VD0|GLGB_PSEA6 1,4-alpha-glucan branching enzyme GlgB OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=glgB PE=3 SV=1 72 680 2.0E-53
sp|Q7VBL4|GLGB_PROMA 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=glgB PE=3 SV=1 66 678 2.0E-53
sp|Q3SH78|GLGB_THIDA 1,4-alpha-glucan branching enzyme GlgB OS=Thiobacillus denitrificans (strain ATCC 25259) GN=glgB PE=3 SV=1 66 678 2.0E-53
sp|Q89FD3|GLGB_BRADU 1,4-alpha-glucan branching enzyme GlgB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glgB PE=3 SV=1 45 642 3.0E-53
sp|Q11EX1|GLGB_CHESB 1,4-alpha-glucan branching enzyme GlgB OS=Chelativorans sp. (strain BNC1) GN=glgB PE=3 SV=1 51 678 5.0E-53
sp|Q5DZB8|GLGB_VIBF1 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glgB PE=3 SV=1 66 644 6.0E-53
sp|A2C142|GLGB_PROM1 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain NATL1A) GN=glgB PE=3 SV=1 33 681 8.0E-53
sp|Q9KNE8|GLGB_VIBCH 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glgB PE=3 SV=1 66 644 1.0E-52
sp|Q0AGJ0|GLGB_NITEC 1,4-alpha-glucan branching enzyme GlgB OS=Nitrosomonas eutropha (strain C91) GN=glgB PE=3 SV=1 51 678 1.0E-52
sp|Q31BV0|GLGB_PROM9 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9312) GN=glgB PE=3 SV=1 29 642 2.0E-52
sp|A8G3V0|GLGB_PROM2 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9215) GN=glgB PE=3 SV=1 33 642 2.0E-52
sp|Q0SSN2|GLGB2_CLOPS 1,4-alpha-glucan branching enzyme GlgB 2 OS=Clostridium perfringens (strain SM101 / Type A) GN=glgB2 PE=3 SV=1 46 681 2.0E-52
sp|A6WKY2|GLGB_SHEB8 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS185) GN=glgB PE=3 SV=1 45 679 3.0E-52
sp|Q8DLB8|GLGB_THEEB 1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus elongatus (strain BP-1) GN=glgB PE=3 SV=1 51 678 3.0E-52
sp|Q46LW6|GLGB_PROMT 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain NATL2A) GN=glgB PE=3 SV=1 33 681 4.0E-52
sp|Q608L5|GLGB_METCA 1,4-alpha-glucan branching enzyme GlgB OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=glgB PE=3 SV=1 66 679 4.0E-52
sp|Q5Z0W8|GLGB_NOCFA 1,4-alpha-glucan branching enzyme GlgB OS=Nocardia farcinica (strain IFM 10152) GN=glgB PE=3 SV=1 61 678 4.0E-52
sp|A3D286|GLGB_SHEB5 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=glgB PE=3 SV=1 45 679 4.0E-52
sp|A2BQ65|GLGB_PROMS 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain AS9601) GN=glgB PE=3 SV=1 33 642 5.0E-52
sp|B8EAX1|GLGB_SHEB2 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS223) GN=glgB PE=3 SV=1 45 679 7.0E-52
sp|Q2YB47|GLGB_NITMU 1,4-alpha-glucan branching enzyme GlgB OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=glgB PE=3 SV=1 66 678 8.0E-52
sp|Q2S4A0|GLGB_SALRD 1,4-alpha-glucan branching enzyme GlgB OS=Salinibacter ruber (strain DSM 13855 / M31) GN=glgB PE=3 SV=1 48 678 9.0E-52
sp|P39118|GLGB_BACSU 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus subtilis (strain 168) GN=glgB PE=2 SV=1 42 642 1.0E-51
sp|Q1QNB1|GLGB_NITHX 1,4-alpha-glucan branching enzyme GlgB OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=glgB PE=3 SV=1 51 654 1.0E-51
sp|Q4KCQ3|GLGB_PSEF5 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=glgB PE=3 SV=1 66 642 1.0E-51
sp|A3PBV8|GLGB_PROM0 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9301) GN=glgB PE=3 SV=1 33 642 1.0E-51
sp|Q93HU3|GLGB_RHOMR 1,4-alpha-glucan branching enzyme GlgB OS=Rhodothermus marinus GN=glgB PE=3 SV=1 48 678 2.0E-51
sp|A2BVP7|GLGB_PROM5 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9515) GN=glgB PE=3 SV=1 34 642 2.0E-51
sp|Q133N2|GLGB_RHOPS 1,4-alpha-glucan branching enzyme GlgB OS=Rhodopseudomonas palustris (strain BisB5) GN=glgB PE=3 SV=1 51 642 2.0E-51
sp|Q8XK15|GLGB2_CLOPE 1,4-alpha-glucan branching enzyme GlgB 2 OS=Clostridium perfringens (strain 13 / Type A) GN=glgB2 PE=3 SV=1 46 681 3.0E-51
sp|Q3JCN0|GLGB_NITOC 1,4-alpha-glucan branching enzyme GlgB OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=glgB PE=3 SV=1 66 681 3.0E-51
sp|Q07K87|GLGB_RHOP5 1,4-alpha-glucan branching enzyme GlgB OS=Rhodopseudomonas palustris (strain BisA53) GN=glgB PE=3 SV=1 45 642 3.0E-51
sp|Q81ZU6|GLGB_NITEU 1,4-alpha-glucan branching enzyme GlgB OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=glgB PE=3 SV=1 51 678 3.0E-51
sp|A9KTJ1|GLGB_SHEB9 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS195) GN=glgB PE=3 SV=1 45 679 3.0E-51
sp|A5EPZ7|GLGB_BRASB 1,4-alpha-glucan branching enzyme GlgB OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=glgB PE=3 SV=1 31 660 4.0E-51
sp|A3PIQ5|GLGB_RHOS1 1,4-alpha-glucan branching enzyme GlgB OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=glgB PE=3 SV=1 66 678 4.0E-51
sp|Q3J3M6|GLGB_RHOS4 1,4-alpha-glucan branching enzyme GlgB OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=glgB PE=3 SV=1 66 678 4.0E-51
sp|Q8D4P0|GLGB_VIBVU 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio vulnificus (strain CMCP6) GN=glgB PE=3 SV=1 71 642 4.0E-51
sp|A4Z005|GLGB_BRASO 1,4-alpha-glucan branching enzyme GlgB OS=Bradyrhizobium sp. (strain ORS278) GN=glgB PE=3 SV=1 31 642 5.0E-51
sp|Q2JZ21|GLGB2_RHIEC 1,4-alpha-glucan branching enzyme GlgB 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=glgB2 PE=3 SV=1 43 678 5.0E-51
sp|Q7MG90|GLGB_VIBVY 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio vulnificus (strain YJ016) GN=glgB PE=3 SV=2 71 651 5.0E-51
sp|Q3STC2|GLGB_NITWN 1,4-alpha-glucan branching enzyme GlgB OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=glgB PE=3 SV=1 45 655 6.0E-51
sp|Q7NL20|GLGB_GLOVI 1,4-alpha-glucan branching enzyme GlgB OS=Gloeobacter violaceus (strain PCC 7421) GN=glgB PE=3 SV=1 51 681 7.0E-51
sp|Q3KD78|GLGB_PSEPF 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas fluorescens (strain Pf0-1) GN=glgB PE=3 SV=1 66 678 7.0E-51
sp|Q7V8B5|GLGB_PROMM 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9313) GN=glgB PE=3 SV=1 34 678 7.0E-51
sp|Q2RR72|GLGB_RHORT 1,4-alpha-glucan branching enzyme GlgB OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=glgB PE=3 SV=1 31 678 8.0E-51
sp|O66936|GLGB_AQUAE 1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) GN=glgB PE=3 SV=1 50 678 8.0E-51
sp|Q87FR0|GLGB_VIBPA 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glgB PE=3 SV=1 66 651 1.0E-50
sp|Q0TQ16|GLGB_CLOP1 1,4-alpha-glucan branching enzyme GlgB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=glgB PE=3 SV=1 46 681 1.0E-50
sp|Q5NXV7|GLGB_AROAE 1,4-alpha-glucan branching enzyme GlgB OS=Aromatoleum aromaticum (strain EbN1) GN=glgB PE=3 SV=1 48 678 1.0E-50
sp|Q6N3P9|GLGB_RHOPA 1,4-alpha-glucan branching enzyme GlgB OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=glgB PE=3 SV=1 51 642 1.0E-50
sp|Q6NHR6|GLGB_CORDI 1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=glgB PE=3 SV=1 60 674 1.0E-50
sp|A2CAR9|GLGB_PROM3 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9303) GN=glgB PE=3 SV=1 34 678 1.0E-50
sp|Q3AYE2|GLGB_SYNS9 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain CC9902) GN=glgB PE=3 SV=1 34 642 2.0E-50
sp|Q1H1K2|GLGB_METFK 1,4-alpha-glucan branching enzyme GlgB OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=glgB PE=3 SV=1 3 636 2.0E-50
sp|Q2T6R3|GLGB_BURTA 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=glgB PE=3 SV=1 35 640 2.0E-50
sp|P52981|GLGB_SYNY3 1,4-alpha-glucan branching enzyme GlgB OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glgB PE=1 SV=1 42 678 3.0E-50
sp|Q6CZK0|GLGB_PECAS 1,4-alpha-glucan branching enzyme GlgB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glgB PE=3 SV=1 51 681 3.0E-50
sp|Q7V299|GLGB_PROMP 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=glgB PE=3 SV=1 33 642 4.0E-50
sp|Q47II8|GLGB_DECAR 1,4-alpha-glucan branching enzyme GlgB OS=Dechloromonas aromatica (strain RCB) GN=glgB PE=3 SV=1 51 681 7.0E-50
sp|Q3AKV6|GLGB_SYNSC 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain CC9605) GN=glgB PE=3 SV=1 34 678 8.0E-50
sp|A0Q593|GLGB_FRATN 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. novicida (strain U112) GN=glgB PE=3 SV=1 42 678 1.0E-49
sp|Q2W2Q6|GLGB_MAGSA 1,4-alpha-glucan branching enzyme GlgB OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=glgB PE=3 SV=1 31 681 1.0E-49
sp|Q210H1|GLGB_RHOPB 1,4-alpha-glucan branching enzyme GlgB OS=Rhodopseudomonas palustris (strain BisB18) GN=glgB PE=3 SV=1 45 642 2.0E-49
sp|A1U0K1|GLGB_MARHV 1,4-alpha-glucan branching enzyme GlgB OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=glgB PE=3 SV=1 71 678 2.0E-49
sp|A5GJR7|GLGB_SYNPW 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain WH7803) GN=glgB PE=3 SV=1 66 678 2.0E-49
sp|B7IM37|GLGB_BACC2 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain G9842) GN=glgB PE=3 SV=1 39 678 3.0E-49
sp|Q8YYX9|GLGB_NOSS1 1,4-alpha-glucan branching enzyme GlgB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=glgB PE=3 SV=1 51 678 5.0E-49
sp|Q7U646|GLGB_SYNPX 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain WH8102) GN=glgB PE=3 SV=1 34 678 5.0E-49
sp|A1JSJ0|GLGB_YERE8 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=glgB PE=3 SV=1 51 642 6.0E-49
sp|Q2JT08|GLGB_SYNJA 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain JA-3-3Ab) GN=glgB PE=3 SV=1 51 678 6.0E-49
sp|Q816G6|GLGB_BACCR 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glgB PE=3 SV=1 39 678 8.0E-49
sp|Q8PDD1|GLGB2_XANCP 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glgB2 PE=3 SV=1 59 678 9.0E-49
sp|Q4UZL7|GLGB2_XANC8 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=glgB2 PE=3 SV=1 59 678 9.0E-49
sp|B7HBC7|GLGB_BACC4 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain B4264) GN=glgB PE=3 SV=1 39 678 1.0E-48
sp|A6V628|GLGB_PSEA7 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas aeruginosa (strain PA7) GN=glgB PE=3 SV=1 66 678 2.0E-48
sp|Q664I2|GLGB_YERPS 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glgB PE=3 SV=1 23 642 2.0E-48
sp|A4TQV2|GLGB_YERPP 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pestis (strain Pestoides F) GN=glgB PE=3 SV=1 23 642 2.0E-48
sp|Q1CDL3|GLGB_YERPN 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=glgB PE=3 SV=1 23 642 2.0E-48
sp|Q8ZA75|GLGB_YERPE 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pestis GN=glgB PE=3 SV=1 23 642 2.0E-48
sp|Q1C1D9|GLGB_YERPA 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=glgB PE=3 SV=1 23 642 2.0E-48
sp|P30537|GLGB_BACCL 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus caldolyticus GN=glgB PE=1 SV=1 42 646 2.0E-48
sp|Q8NR40|GLGB_CORGL 1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glgB PE=3 SV=1 41 675 2.0E-48
sp|Q9I1W2|GLGB_PSEAE 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glgB PE=3 SV=1 66 642 3.0E-48
sp|Q4JUK5|GLGB_CORJK 1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium jeikeium (strain K411) GN=glgB PE=3 SV=1 53 675 3.0E-48
sp|Q73X75|GLGB_MYCPA 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=glgB PE=3 SV=1 23 681 3.0E-48
sp|Q6LHN1|GLGB_PHOPR 1,4-alpha-glucan branching enzyme GlgB OS=Photobacterium profundum GN=glgB PE=3 SV=1 62 642 4.0E-48
sp|P30538|GLGB_GEOSE 1,4-alpha-glucan branching enzyme GlgB OS=Geobacillus stearothermophilus GN=glgB PE=1 SV=1 42 678 4.0E-48
sp|A1RLX8|GLGB_SHESW 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella sp. (strain W3-18-1) GN=glgB PE=3 SV=1 45 679 4.0E-48
sp|Q47SE7|GLGB_THEFY 1,4-alpha-glucan branching enzyme GlgB OS=Thermobifida fusca (strain YX) GN=glgB PE=3 SV=1 54 671 5.0E-48
sp|Q0SGR9|GLGB_RHOJR 1,4-alpha-glucan branching enzyme GlgB OS=Rhodococcus jostii (strain RHA1) GN=glgB PE=3 SV=1 31 676 5.0E-48
sp|A7FNX5|GLGB_YERP3 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=glgB PE=3 SV=1 23 642 5.0E-48
sp|Q632H1|GLGB_BACCZ 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain ZK / E33L) GN=glgB PE=3 SV=1 47 646 5.0E-48
sp|Q0BN67|GLGB_FRATO 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=glgB PE=3 SV=1 66 678 5.0E-48
sp|A7NAI2|GLGB_FRATF 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=glgB PE=3 SV=1 66 678 5.0E-48
sp|Q881X0|GLGB_PSESM 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glgB PE=3 SV=1 66 681 7.0E-48
sp|Q0I8Y2|GLGB_SYNS3 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain CC9311) GN=glgB PE=3 SV=1 34 640 7.0E-48
sp|Q2A4U7|GLGB_FRATH 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. holarctica (strain LVS) GN=glgB PE=3 SV=1 66 678 8.0E-48
sp|Q81K82|GLGB_BACAN 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus anthracis GN=glgB PE=3 SV=1 39 678 9.0E-48
sp|C3LC26|GLGB_BACAC 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=glgB PE=3 SV=1 39 678 9.0E-48
sp|C3PCL8|GLGB_BACAA 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus anthracis (strain A0248) GN=glgB PE=3 SV=1 39 678 9.0E-48
sp|A4Y4U3|GLGB_SHEPC 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=glgB PE=3 SV=1 71 679 1.0E-47
sp|Q4ZTJ2|GLGB_PSEU2 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas syringae pv. syringae (strain B728a) GN=glgB PE=3 SV=1 66 681 1.0E-47
sp|Q48IE2|GLGB_PSE14 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=glgB PE=3 SV=1 66 681 1.0E-47
sp|Q3M473|GLGB_ANAVT 1,4-alpha-glucan branching enzyme GlgB OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=glgB PE=3 SV=1 51 678 1.0E-47
sp|Q6HC15|GLGB_BACHK 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glgB PE=3 SV=1 39 678 1.0E-47
sp|B7JDF1|GLGB_BACC0 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain AH820) GN=glgB PE=3 SV=1 39 678 1.0E-47
sp|A4IZK2|GLGB_FRATW 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=glgB PE=3 SV=1 66 678 1.0E-47
sp|C1EX54|GLGB_BACC3 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain 03BB102) GN=glgB PE=3 SV=1 39 678 2.0E-47
sp|B9J2G8|GLGB_BACCQ 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain Q1) GN=glgB PE=3 SV=1 39 646 2.0E-47
sp|Q72YJ3|GLGB_BACC1 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glgB PE=3 SV=1 39 646 2.0E-47
sp|Q0K0X8|GLGB_CUPNH 1,4-alpha-glucan branching enzyme GlgB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=glgB PE=3 SV=1 66 678 2.0E-47
sp|Q0HGI8|GLGB_SHESM 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella sp. (strain MR-4) GN=glgB PE=3 SV=1 71 679 2.0E-47
sp|Q8PR13|GLGB1_XANAC 1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glgB1 PE=3 SV=1 71 640 2.0E-47
sp|Q1M3A7|GLGB2_RHIL3 1,4-alpha-glucan branching enzyme GlgB 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=glgB2 PE=3 SV=1 43 421 2.0E-47
sp|Q9Z876|GLGB_CHLPN 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydia pneumoniae GN=glgB PE=3 SV=1 51 642 3.0E-47
sp|Q890J1|GLGB_LACPL 1,4-alpha-glucan branching enzyme GlgB OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glgB PE=3 SV=1 56 678 3.0E-47
sp|B7HTX9|GLGB_BACC7 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain AH187) GN=glgB PE=3 SV=1 43 646 3.0E-47
sp|B2SFM7|GLGB_FRATM 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=glgB PE=3 SV=1 66 678 3.0E-47
sp|Q1AZ86|GLGB_RUBXD 1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=glgB PE=3 SV=1 51 421 3.0E-47
sp|B0TZI5|GLGB_FRAP2 1,4-alpha-glucan branching enzyme GlgB OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=glgB PE=3 SV=1 42 681 5.0E-47
sp|Q5H6H2|GLGB1_XANOR 1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=glgB1 PE=3 SV=1 71 642 5.0E-47
sp|A1KIB6|GLGB_MYCBP 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=glgB PE=3 SV=1 23 678 5.0E-47
sp|P59816|GLGB_MYCBO 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glgB PE=3 SV=1 23 678 5.0E-47
sp|Q9RTB7|GLGB_DEIRA 1,4-alpha-glucan branching enzyme GlgB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glgB PE=3 SV=1 66 678 6.0E-47
sp|Q0HST5|GLGB_SHESR 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella sp. (strain MR-7) GN=glgB PE=3 SV=1 71 679 6.0E-47
sp|Q2P949|GLGB2_XANOM 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=glgB2 PE=3 SV=1 71 642 6.0E-47
sp|Q46TF2|GLGB_CUPPJ 1,4-alpha-glucan branching enzyme GlgB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=glgB PE=3 SV=1 5 678 7.0E-47
sp|Q1WSM8|GLGB_LACS1 1,4-alpha-glucan branching enzyme GlgB OS=Lactobacillus salivarius (strain UCC118) GN=glgB PE=3 SV=1 67 681 9.0E-47
sp|Q21WG7|GLGB_RHOFT 1,4-alpha-glucan branching enzyme GlgB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=glgB PE=3 SV=1 53 678 1.0E-46
sp|A3N8B3|GLGB_BURP6 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia pseudomallei (strain 668) GN=glgB PE=3 SV=1 66 651 1.0E-46
sp|Q6L2Z9|GLGB_PICTO 1,4-alpha-glucan branching enzyme GlgB OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=glgB PE=3 SV=1 31 678 1.0E-46
sp|B0B998|GLGB_CHLT2 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=glgB PE=3 SV=1 42 421 1.0E-46
sp|Q63T91|GLGB_BURPS 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia pseudomallei (strain K96243) GN=glgB PE=3 SV=1 66 651 1.0E-46
sp|B0BAX7|GLGB_CHLTB 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=glgB PE=3 SV=1 42 421 1.0E-46
sp|Q88FN1|GLGB_PSEPK 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas putida (strain KT2440) GN=glgB PE=3 SV=1 66 678 1.0E-46
sp|Q5NHN4|GLGB_FRATT 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=glgB PE=3 SV=1 66 678 1.0E-46
sp|Q14J36|GLGB_FRAT1 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=glgB PE=3 SV=1 66 678 1.0E-46
sp|Q65TI0|GLGB_MANSM 1,4-alpha-glucan branching enzyme GlgB OS=Mannheimia succiniciproducens (strain MBEL55E) GN=glgB PE=3 SV=1 24 681 2.0E-46
sp|Q3BZE1|GLGB1_XANC5 1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=glgB1 PE=3 SV=1 71 640 2.0E-46
sp|P30539|GLGB_BUTFI 1,4-alpha-glucan branching enzyme GlgB OS=Butyrivibrio fibrisolvens GN=glgB PE=1 SV=1 53 431 2.0E-46
sp|O84874|GLGB_CHLTR 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=glgB PE=3 SV=1 42 421 2.0E-46
sp|A4WFL5|GLGB_ENT38 1,4-alpha-glucan branching enzyme GlgB OS=Enterobacter sp. (strain 638) GN=glgB PE=3 SV=1 51 681 2.0E-46
sp|Q1D654|GLGB_MYXXD 1,4-alpha-glucan branching enzyme GlgB OS=Myxococcus xanthus (strain DK 1622) GN=glgB PE=3 SV=1 51 676 2.0E-46
sp|Q8PQA2|GLGB2_XANAC 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glgB2 PE=3 SV=1 11 678 2.0E-46
sp|Q3BYI0|GLGB2_XANC5 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=glgB2 PE=3 SV=1 59 678 2.0E-46
sp|Q3JTG5|GLGB_BURP1 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia pseudomallei (strain 1710b) GN=glgB PE=3 SV=1 66 644 2.0E-46
sp|A3NU16|GLGB_BURP0 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia pseudomallei (strain 1106a) GN=glgB PE=3 SV=1 66 644 2.0E-46
sp|Q2JK68|GLGB_SYNJB 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=glgB PE=3 SV=1 51 678 2.0E-46
sp|Q31VJ1|GLGB_SHIBS 1,4-alpha-glucan branching enzyme GlgB OS=Shigella boydii serotype 4 (strain Sb227) GN=glgB PE=3 SV=1 51 681 2.0E-46
sp|Q8PE48|GLGB1_XANCP 1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glgB1 PE=3 SV=1 71 640 3.0E-46
sp|Q4V0E2|GLGB1_XANC8 1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=glgB1 PE=3 SV=1 71 640 3.0E-46
sp|P9WN44|GLGB_MYCTO 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glgB PE=3 SV=1 23 678 4.0E-46
sp|A5GSG4|GLGB_SYNR3 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain RCC307) GN=glgB PE=3 SV=1 32 642 5.0E-46
sp|Q3YW93|GLGB_SHISS 1,4-alpha-glucan branching enzyme GlgB OS=Shigella sonnei (strain Ss046) GN=glgB PE=3 SV=1 51 681 5.0E-46
sp|P07762|GLGB_ECOLI 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli (strain K12) GN=glgB PE=1 SV=1 51 681 5.0E-46
sp|B1IP32|GLGB_ECOLC 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glgB PE=3 SV=1 51 681 5.0E-46
sp|A8A5P2|GLGB_ECOHS 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O9:H4 (strain HS) GN=glgB PE=3 SV=1 51 681 5.0E-46
sp|A7ZSW5|GLGB_ECO24 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glgB PE=3 SV=1 51 681 5.0E-46
sp|Q8EGU7|GLGB_SHEON 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella oneidensis (strain MR-1) GN=glgB PE=3 SV=2 71 679 5.0E-46
sp|Q9RQI5|GLGB_BERDE 1,4-alpha-glucan branching enzyme GlgB OS=Bergeriella denitrificans GN=glgB PE=3 SV=1 45 642 5.0E-46
sp|Q0I3H7|GLGB_HAES1 1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus somnus (strain 129Pt) GN=glgB PE=3 SV=1 48 678 6.0E-46
sp|Q32AV3|GLGB_SHIDS 1,4-alpha-glucan branching enzyme GlgB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glgB PE=3 SV=1 51 681 9.0E-46
sp|Q985P4|GLGB_RHILO 1,4-alpha-glucan branching enzyme GlgB OS=Rhizobium loti (strain MAFF303099) GN=glgB PE=3 SV=1 48 422 1.0E-45
sp|Q1IZQ3|GLGB_DEIGD 1,4-alpha-glucan branching enzyme GlgB OS=Deinococcus geothermalis (strain DSM 11300) GN=glgB PE=3 SV=1 66 678 1.0E-45
sp|P9WN45|GLGB_MYCTU 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glgB PE=1 SV=1 23 678 1.0E-45
sp|A5U226|GLGB_MYCTA 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=glgB PE=3 SV=1 23 678 1.0E-45
sp|Q114I1|GLGB_TRIEI 1,4-alpha-glucan branching enzyme GlgB OS=Trichodesmium erythraeum (strain IMS101) GN=glgB PE=3 SV=1 51 642 1.0E-45
sp|Q7UVH1|GLGB_RHOBA 1,4-alpha-glucan branching enzyme GlgB OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=glgB PE=3 SV=1 66 678 1.0E-45
sp|Q0SZN2|GLGB_SHIF8 1,4-alpha-glucan branching enzyme GlgB OS=Shigella flexneri serotype 5b (strain 8401) GN=glgB PE=3 SV=1 51 681 1.0E-45
sp|Q3KKH0|GLGB_CHLTA 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=glgB PE=3 SV=1 42 421 1.0E-45
sp|Q0TC27|GLGB_ECOL5 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glgB PE=3 SV=1 51 681 1.0E-45
sp|P52980|GLGB_STRAU 1,4-alpha-glucan branching enzyme GlgB OS=Streptomyces aureofaciens GN=glgB PE=3 SV=1 71 678 2.0E-45
sp|A3MZ64|GLGB_ACTP2 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=glgB PE=3 SV=1 51 642 2.0E-45
sp|B0UU89|GLGB_HISS2 1,4-alpha-glucan branching enzyme GlgB OS=Histophilus somni (strain 2336) GN=glgB PE=3 SV=1 48 678 2.0E-45
sp|Q0SWZ1|GLGB1_CLOPS 1,4-alpha-glucan branching enzyme GlgB 1 OS=Clostridium perfringens (strain SM101 / Type A) GN=glgB1 PE=3 SV=1 52 652 2.0E-45
sp|Q83PV3|GLGB_SHIFL 1,4-alpha-glucan branching enzyme GlgB OS=Shigella flexneri GN=glgB PE=3 SV=1 51 681 2.0E-45
sp|Q8XPA2|GLGB1_CLOPE 1,4-alpha-glucan branching enzyme GlgB 1 OS=Clostridium perfringens (strain 13 / Type A) GN=glgB1 PE=3 SV=1 52 678 2.0E-45
sp|A9VMV8|GLGB_BACWK 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus weihenstephanensis (strain KBAB4) GN=glgB PE=3 SV=1 43 678 2.0E-45
sp|Q57IT8|GLGB_SALCH 1,4-alpha-glucan branching enzyme GlgB OS=Salmonella choleraesuis (strain SC-B67) GN=glgB PE=3 SV=1 51 681 2.0E-45
sp|Q8Z235|GLGB_SALTI 1,4-alpha-glucan branching enzyme GlgB OS=Salmonella typhi GN=glgB PE=3 SV=1 51 681 3.0E-45
sp|B3PGN4|GLGB_CELJU 1,4-alpha-glucan branching enzyme GlgB OS=Cellvibrio japonicus (strain Ueda107) GN=glgB PE=3 SV=1 64 668 3.0E-45
sp|Q8X6X6|GLGB_ECO57 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O157:H7 GN=glgB PE=3 SV=1 51 681 3.0E-45
sp|A8GKV0|GLGB_SERP5 1,4-alpha-glucan branching enzyme GlgB OS=Serratia proteamaculans (strain 568) GN=glgB PE=3 SV=1 51 421 4.0E-45
sp|P45177|GLGB_HAEIN 1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glgB PE=3 SV=1 24 681 4.0E-45
sp|Q5PM06|GLGB_SALPA 1,4-alpha-glucan branching enzyme GlgB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glgB PE=3 SV=1 51 681 4.0E-45
sp|A5UEJ2|GLGB_HAEIG 1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain PittGG) GN=glgB PE=3 SV=1 24 681 4.0E-45
sp|Q4QK67|GLGB_HAEI8 1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain 86-028NP) GN=glgB PE=3 SV=1 24 681 5.0E-45
sp|Q9PL51|GLGB_CHLMU 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydia muridarum (strain MoPn / Nigg) GN=glgB PE=3 SV=1 42 421 5.0E-45
sp|Q8ZLG5|GLGB_SALTY 1,4-alpha-glucan branching enzyme GlgB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glgB PE=3 SV=1 51 681 5.0E-45
sp|B0BT96|GLGB_ACTPJ 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=glgB PE=3 SV=1 51 642 6.0E-45
sp|A9MTV4|GLGB_SALPB 1,4-alpha-glucan branching enzyme GlgB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glgB PE=3 SV=1 51 681 6.0E-45
sp|Q8FCR7|GLGB_ECOL6 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glgB PE=3 SV=1 51 681 7.0E-45
sp|Q8XT76|GLGB_RALSO 1,4-alpha-glucan branching enzyme GlgB OS=Ralstonia solanacearum (strain GMI1000) GN=glgB PE=3 SV=1 66 678 8.0E-45
sp|Q5H6Q3|GLGB2_XANOR 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=glgB2 PE=3 SV=2 11 678 8.0E-45
sp|A9MMA0|GLGB_SALAR 1,4-alpha-glucan branching enzyme GlgB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=glgB PE=3 SV=1 51 681 8.0E-45
sp|B3H0J1|GLGB_ACTP7 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=glgB PE=3 SV=1 51 642 8.0E-45
sp|Q0BU54|GLGB_GRABC 1,4-alpha-glucan branching enzyme GlgB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=glgB PE=3 SV=1 66 640 1.0E-44
sp|Q5L6K4|GLGB_CHLAB 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=glgB PE=3 SV=1 42 642 1.0E-44
sp|Q1R5J4|GLGB_ECOUT 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli (strain UTI89 / UPEC) GN=glgB PE=3 SV=1 51 681 1.0E-44
sp|A1AGW5|GLGB_ECOK1 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O1:K1 / APEC GN=glgB PE=3 SV=1 51 681 1.0E-44
sp|Q5FL68|GLGB_LACAC 1,4-alpha-glucan branching enzyme GlgB OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=glgB PE=3 SV=1 36 678 2.0E-44
sp|Q2P9F7|GLGB1_XANOM 1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=glgB1 PE=3 SV=1 11 678 2.0E-44
sp|Q6AEU4|GLGB_LEIXX 1,4-alpha-glucan branching enzyme GlgB OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glgB PE=3 SV=1 60 636 2.0E-44
sp|A0PUI6|GLGB_MYCUA 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium ulcerans (strain Agy99) GN=glgB PE=3 SV=1 41 678 5.0E-44
sp|Q8FQ12|GLGB_COREF 1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=glgB PE=3 SV=1 41 651 5.0E-44
sp|Q39N89|GLGB_BURL3 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=glgB PE=3 SV=1 63 653 6.0E-44
sp|A4JR39|GLGB_BURVG 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=glgB PE=3 SV=1 64 653 7.0E-44
sp|A6TF51|GLGB_KLEP7 1,4-alpha-glucan branching enzyme GlgB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=glgB PE=3 SV=1 51 681 2.0E-43
sp|Q823Y5|GLGB_CHLCV 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydophila caviae (strain GPIC) GN=glgB PE=3 SV=1 53 421 2.0E-43
sp|Q253M6|GLGB_CHLFF 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydophila felis (strain Fe/C-56) GN=glgB PE=3 SV=1 66 421 2.0E-43
sp|Q65FS4|GLGB_BACLD 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glgB PE=3 SV=1 71 642 2.0E-43
sp|A0R1Y4|GLGB_MYCS2 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glgB PE=3 SV=1 61 676 2.0E-43
sp|Q13S07|GLGB_BURXL 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia xenovorans (strain LB400) GN=glgB PE=3 SV=1 66 642 3.0E-43
sp|A7GUA1|GLGB_BACCN 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=glgB PE=3 SV=1 53 678 3.0E-43
sp|Q82JF0|GLGB1_STRAW 1,4-alpha-glucan branching enzyme GlgB 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glgB1 PE=3 SV=1 71 678 5.0E-43
sp|A8AQY3|GLGB_CITK8 1,4-alpha-glucan branching enzyme GlgB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glgB PE=3 SV=1 51 681 8.0E-43
sp|Q6MAB4|GLGB_PARUW 1,4-alpha-glucan branching enzyme GlgB OS=Protochlamydia amoebophila (strain UWE25) GN=glgB PE=3 SV=1 66 642 1.0E-42
sp|Q825Q8|GLGB2_STRAW 1,4-alpha-glucan branching enzyme GlgB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glgB2 PE=3 SV=1 71 651 2.0E-42
sp|Q9CN94|GLGB_PASMU 1,4-alpha-glucan branching enzyme GlgB OS=Pasteurella multocida (strain Pm70) GN=glgB PE=3 SV=1 48 678 3.0E-42
sp|Q2K487|GLGB1_RHIEC 1,4-alpha-glucan branching enzyme GlgB 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=glgB1 PE=3 SV=1 48 422 3.0E-42
sp|Q081Q4|GLGB_SHEFN 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella frigidimarina (strain NCIMB 400) GN=glgB PE=3 SV=1 71 677 5.0E-42
sp|Q30Z14|GLGB_DESAG 1,4-alpha-glucan branching enzyme GlgB OS=Desulfovibrio alaskensis (strain G20) GN=glgB PE=3 SV=1 53 636 5.0E-42
sp|Q0B3Y4|GLGB_BURCM 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=glgB PE=3 SV=1 66 653 8.0E-42
sp|Q2G7S5|GLGB_NOVAD 1,4-alpha-glucan branching enzyme GlgB OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=glgB PE=3 SV=1 51 642 1.0E-41
sp|Q8U8L4|GLGB_AGRFC 1,4-alpha-glucan branching enzyme GlgB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glgB PE=3 SV=1 71 422 2.0E-41
sp|A6VP15|GLGB_ACTSZ 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=glgB PE=3 SV=1 48 642 2.0E-41
sp|Q8E5V8|GLGB_STRA3 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glgB PE=3 SV=1 63 672 2.0E-41
sp|Q8E081|GLGB_STRA5 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glgB PE=3 SV=1 63 672 2.0E-41
sp|Q3K1K5|GLGB_STRA1 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=glgB PE=3 SV=1 63 672 2.0E-41
sp|Q8G5L0|GLGB_BIFLO 1,4-alpha-glucan branching enzyme GlgB OS=Bifidobacterium longum (strain NCC 2705) GN=glgB PE=3 SV=1 62 644 3.0E-41
sp|Q28MN2|GLGB_JANSC 1,4-alpha-glucan branching enzyme GlgB OS=Jannaschia sp. (strain CCS1) GN=glgB PE=3 SV=2 53 421 3.0E-41
sp|Q1BVW7|GLGB_BURCA 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia cenocepacia (strain AU 1054) GN=glgB PE=3 SV=1 63 653 5.0E-41
sp|A0KDG4|GLGB_BURCH 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia cenocepacia (strain HI2424) GN=glgB PE=3 SV=1 63 653 5.0E-41
sp|P52979|GLGB_RHIRD 1,4-alpha-glucan branching enzyme GlgB OS=Rhizobium radiobacter GN=glgB PE=3 SV=2 43 422 1.0E-40
sp|Q1MBS9|GLGB1_RHIL3 1,4-alpha-glucan branching enzyme GlgB 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=glgB1 PE=3 SV=1 48 422 1.0E-40
sp|Q92M14|GLGB_RHIME 1,4-alpha-glucan branching enzyme GlgB OS=Rhizobium meliloti (strain 1021) GN=glgB PE=3 SV=1 71 422 2.0E-40
sp|Q59832|GLGB2_STRCO 1,4-alpha-glucan branching enzyme GlgB 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glgB2 PE=3 SV=2 71 656 3.0E-40
sp|Q59833|GLGB1_STRCO 1,4-alpha-glucan branching enzyme GlgB 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glgB1 PE=3 SV=2 71 651 4.0E-40
sp|Q7WII7|GLGB_BORBR 1,4-alpha-glucan branching enzyme GlgB OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glgB PE=3 SV=1 71 678 4.0E-40
sp|Q0AA26|GLGB_ALKEH 1,4-alpha-glucan branching enzyme GlgB OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=glgB PE=3 SV=1 66 681 4.0E-40
sp|Q7VYK0|GLGB_BORPE 1,4-alpha-glucan branching enzyme GlgB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glgB PE=3 SV=1 71 678 5.0E-40
sp|Q7W6L4|GLGB_BORPA 1,4-alpha-glucan branching enzyme GlgB OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glgB PE=3 SV=1 71 678 5.0E-40
sp|Q97QS8|GLGB_STRPN 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glgB PE=3 SV=1 67 677 8.0E-40
sp|Q8DPS6|GLGB_STRR6 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glgB PE=3 SV=1 67 677 3.0E-39
sp|Q04KG8|GLGB_STRP2 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=glgB PE=3 SV=1 67 677 3.0E-39
sp|Q1B568|GLGB_MYCSS 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium sp. (strain MCS) GN=glgB PE=3 SV=1 19 676 3.0E-39
sp|A1UJW9|GLGB_MYCSK 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium sp. (strain KMS) GN=glgB PE=3 SV=1 19 676 3.0E-39
sp|Q729V5|GLGB_DESVH 1,4-alpha-glucan branching enzyme GlgB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=glgB PE=3 SV=1 63 651 3.0E-39
sp|Q8DT52|GLGB_STRMU 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=glgB PE=3 SV=1 56 672 3.0E-39
sp|A1VC54|GLGB_DESVV 1,4-alpha-glucan branching enzyme GlgB OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=glgB PE=3 SV=1 63 651 5.0E-39
sp|Q6A8Q7|GLGB_PROAC 1,4-alpha-glucan branching enzyme GlgB OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=glgB PE=3 SV=1 42 431 1.0E-38
sp|A3Q396|GLGB_MYCSJ 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium sp. (strain JLS) GN=glgB PE=3 SV=1 19 676 1.0E-38
sp|Q165E2|GLGB_ROSDO 1,4-alpha-glucan branching enzyme GlgB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=glgB PE=3 SV=1 31 640 2.0E-38
sp|Q8GQC5|GLGB_DICCH 1,4-alpha-glucan branching enzyme GlgB OS=Dickeya chrysanthemi GN=glgB PE=1 SV=1 51 681 3.0E-38
sp|A8AYH3|GLGB_STRGC 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=glgB PE=3 SV=1 68 672 2.0E-37
sp|A3CM01|GLGB_STRSV 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus sanguinis (strain SK36) GN=glgB PE=3 SV=1 68 672 3.0E-37
sp|Q2J6Q9|GLGB_FRASC 1,4-alpha-glucan branching enzyme GlgB OS=Frankia sp. (strain CcI3) GN=glgB PE=3 SV=1 66 421 5.0E-36
sp|Q55088|TREZ_SULSF Malto-oligosyltrehalose trehalohydrolase OS=Sulfolobus solfataricus GN=treZ PE=1 SV=2 164 346 7.0E-18
sp|P95867|TREZ_SULSO Malto-oligosyltrehalose trehalohydrolase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=treZ PE=1 SV=1 170 346 5.0E-17
sp|Q9RX51|TREZ_DEIRA Malto-oligosyltrehalose trehalohydrolase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=treZ PE=1 SV=1 183 404 1.0E-16
sp|B7LSE2|GLGX_ESCF3 Glycogen debranching enzyme OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=glgX PE=3 SV=1 142 345 8.0E-12
sp|Q9M0S5|ISOA3_ARATH Isoamylase 3, chloroplastic OS=Arabidopsis thaliana GN=ISA3 PE=2 SV=2 145 340 4.0E-11
sp|A8AQY2|GLGX_CITK8 Glycogen debranching enzyme OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glgX PE=3 SV=1 142 345 3.0E-10
sp|Q44316|TREZ_ARTSQ Malto-oligosyltrehalose trehalohydrolase OS=Arthrobacter sp. (strain Q36) GN=treZ PE=3 SV=1 182 345 6.0E-10
sp|Q31VJ2|GLGX_SHIBS Glycogen debranching enzyme OS=Shigella boydii serotype 4 (strain Sb227) GN=glgX PE=3 SV=1 165 345 7.0E-10
sp|O04196|ISOA1_ARATH Isoamylase 1, chloroplastic OS=Arabidopsis thaliana GN=ISA1 PE=1 SV=1 175 340 1.0E-09
sp|A4WFL4|GLGX_ENT38 Glycogen debranching enzyme OS=Enterobacter sp. (strain 638) GN=glgX PE=3 SV=1 114 345 2.0E-09
sp|Q3YW94|GLGX_SHISS Glycogen debranching enzyme OS=Shigella sonnei (strain Ss046) GN=glgX PE=3 SV=1 165 345 2.0E-09
sp|B5YUI7|GLGX_ECO5E Glycogen debranching enzyme OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=glgX PE=3 SV=1 165 345 4.0E-09
sp|Q8X6X8|GLGX_ECO57 Glycogen debranching enzyme OS=Escherichia coli O157:H7 GN=glgX PE=3 SV=1 165 345 4.0E-09
sp|Q83J89|GLGX_SHIFL Glycogen debranching enzyme OS=Shigella flexneri GN=glgX PE=3 SV=1 165 345 4.0E-09
sp|Q0SZN3|GLGX_SHIF8 Glycogen debranching enzyme OS=Shigella flexneri serotype 5b (strain 8401) GN=glgX PE=3 SV=1 165 345 4.0E-09
sp|B1LI92|GLGX_ECOSM Glycogen debranching enzyme OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=glgX PE=3 SV=1 165 345 4.0E-09
sp|A7ZSW4|GLGX_ECO24 Glycogen debranching enzyme OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glgX PE=3 SV=1 165 345 4.0E-09
sp|B1IP33|GLGX_ECOLC Glycogen debranching enzyme OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glgX PE=3 SV=1 165 345 4.0E-09
sp|A8A5P1|GLGX_ECOHS Glycogen debranching enzyme OS=Escherichia coli O9:H4 (strain HS) GN=glgX PE=3 SV=1 165 345 4.0E-09
sp|B7L4W3|GLGX_ECO55 Glycogen debranching enzyme OS=Escherichia coli (strain 55989 / EAEC) GN=glgX PE=3 SV=1 165 345 4.0E-09
sp|B6I2Z7|GLGX_ECOSE Glycogen debranching enzyme OS=Escherichia coli (strain SE11) GN=glgX PE=3 SV=1 165 345 4.0E-09
sp|B7NE41|GLGX_ECOLU Glycogen debranching enzyme OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=glgX PE=3 SV=1 165 345 4.0E-09
sp|Q0TC28|GLGX_ECOL5 Glycogen debranching enzyme OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glgX PE=3 SV=1 165 345 4.0E-09
sp|P15067|GLGX_ECOLI Glycogen debranching enzyme OS=Escherichia coli (strain K12) GN=glgX PE=1 SV=3 165 345 5.0E-09
sp|B1X776|GLGX_ECODH Glycogen debranching enzyme OS=Escherichia coli (strain K12 / DH10B) GN=glgX PE=3 SV=1 165 345 5.0E-09
sp|C4ZVY1|GLGX_ECOBW Glycogen debranching enzyme OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=glgX PE=3 SV=1 165 345 5.0E-09
sp|B7M2J4|GLGX_ECO8A Glycogen debranching enzyme OS=Escherichia coli O8 (strain IAI1) GN=glgX PE=3 SV=1 165 345 5.0E-09
sp|B2U4G1|GLGX_SHIB3 Glycogen debranching enzyme OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=glgX PE=3 SV=1 165 345 5.0E-09
sp|Q8FCR8|GLGX_ECOL6 Glycogen debranching enzyme OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glgX PE=3 SV=1 165 345 5.0E-09
sp|B7UKY8|GLGX_ECO27 Glycogen debranching enzyme OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=glgX PE=3 SV=1 165 345 5.0E-09
sp|B7NMJ6|GLGX_ECO7I Glycogen debranching enzyme OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=glgX PE=3 SV=1 165 345 5.0E-09
sp|B7N1M3|GLGX_ECO81 Glycogen debranching enzyme OS=Escherichia coli O81 (strain ED1a) GN=glgX PE=3 SV=1 165 345 5.0E-09
sp|Q32AV4|GLGX_SHIDS Glycogen debranching enzyme OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glgX PE=3 SV=1 165 345 5.0E-09
sp|O52520|TREZ_BREHE Malto-oligosyltrehalose trehalohydrolase OS=Brevibacterium helvolum GN=treZ PE=3 SV=1 59 345 5.0E-09
sp|Q9AJN6|TREZ_ARTRM Malto-oligosyltrehalose trehalohydrolase OS=Arthrobacter ramosus GN=treZ PE=3 SV=1 182 345 1.0E-08
sp|A1AGW4|GLGX_ECOK1 Glycogen debranching enzyme OS=Escherichia coli O1:K1 / APEC GN=glgX PE=3 SV=1 165 345 1.0E-08
sp|B7MDR6|GLGX_ECO45 Glycogen debranching enzyme OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=glgX PE=3 SV=1 165 345 1.0E-08
sp|Q1R5J5|GLGX_ECOUT Glycogen debranching enzyme OS=Escherichia coli (strain UTI89 / UPEC) GN=glgX PE=3 SV=1 165 345 1.0E-08
sp|P45178|GLGX_HAEIN Glycogen operon protein GlgX homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glgX PE=3 SV=1 164 345 2.0E-08
sp|Q8Z234|GLGX_SALTI Glycogen debranching enzyme OS=Salmonella typhi GN=glgX PE=3 SV=1 164 345 4.0E-08
sp|B5BHI1|GLGX_SALPK Glycogen debranching enzyme OS=Salmonella paratyphi A (strain AKU_12601) GN=glgX PE=3 SV=1 140 345 6.0E-08
sp|Q5PM07|GLGX_SALPA Glycogen debranching enzyme OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glgX PE=3 SV=1 140 345 6.0E-08
sp|Q53238|TREZ_RHIS1 Malto-oligosyltrehalose trehalohydrolase OS=Rhizobium sp. (strain M-11) GN=treZ PE=3 SV=1 182 345 6.0E-08
sp|A9MTV3|GLGX_SALPB Glycogen debranching enzyme OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glgX PE=3 SV=1 140 345 1.0E-07
sp|B4TY88|GLGX_SALSV Glycogen debranching enzyme OS=Salmonella schwarzengrund (strain CVM19633) GN=glgX PE=3 SV=1 140 345 1.0E-07
sp|B4SVN4|GLGX_SALNS Glycogen debranching enzyme OS=Salmonella newport (strain SL254) GN=glgX PE=3 SV=1 140 345 1.0E-07
sp|B5F8Q3|GLGX_SALA4 Glycogen debranching enzyme OS=Salmonella agona (strain SL483) GN=glgX PE=3 SV=1 140 345 1.0E-07
sp|Q8ZLG6|GLGX_SALTY Glycogen debranching enzyme OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glgX PE=3 SV=1 140 345 1.0E-07
sp|C0Q0L1|GLGX_SALPC Glycogen debranching enzyme OS=Salmonella paratyphi C (strain RKS4594) GN=glgX PE=3 SV=1 140 345 1.0E-07
sp|B4T869|GLGX_SALHS Glycogen debranching enzyme OS=Salmonella heidelberg (strain SL476) GN=glgX PE=3 SV=1 140 345 1.0E-07
sp|Q57IT9|GLGX_SALCH Glycogen debranching enzyme OS=Salmonella choleraesuis (strain SC-B67) GN=glgX PE=3 SV=1 140 345 1.0E-07
sp|Q8KR69|GLGX_DICCH Glycogen debranching enzyme OS=Dickeya chrysanthemi GN=glgX PE=1 SV=1 161 345 2.0E-07
sp|B5R396|GLGX_SALEP Glycogen debranching enzyme OS=Salmonella enteritidis PT4 (strain P125109) GN=glgX PE=3 SV=1 140 345 2.0E-07
sp|B5R7H8|GLGX_SALG2 Glycogen debranching enzyme OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=glgX PE=3 SV=1 140 345 2.0E-07
sp|B5FKF6|GLGX_SALDC Glycogen debranching enzyme OS=Salmonella dublin (strain CT_02021853) GN=glgX PE=3 SV=1 140 345 2.0E-07
sp|Q6CZK1|GLGX_PECAS Glycogen debranching enzyme OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glgX PE=3 SV=1 164 345 2.0E-07
sp|P9WQ23|TREZ_MYCTU Malto-oligosyltrehalose trehalohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=treZ PE=1 SV=1 68 346 6.0E-07
sp|P9WQ22|TREZ_MYCTO Malto-oligosyltrehalose trehalohydrolase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=treZ PE=3 SV=1 68 346 6.0E-07
sp|Q9Y7S9|AMY3_SCHPO Alpha-amylase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah3 PE=1 SV=1 197 348 1.0E-06
sp|A7FNX4|GLGX_YERP3 Glycogen debranching enzyme OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=glgX PE=3 SV=1 165 340 1.0E-06
sp|B2K6G0|GLGX_YERPB Glycogen debranching enzyme OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=glgX PE=3 SV=1 165 340 1.0E-06
sp|L8B068|MALA_HALJP Alpha-amylase MalA OS=Haloarcula japonica GN=malA PE=1 SV=1 182 340 1.0E-06
sp|A9R5L9|GLGX_YERPG Glycogen debranching enzyme OS=Yersinia pestis bv. Antiqua (strain Angola) GN=glgX PE=3 SV=1 165 340 2.0E-06
sp|A1JSI8|GLGX_YERE8 Glycogen debranching enzyme OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=glgX PE=3 SV=1 165 340 2.0E-06
sp|A4TQV1|GLGX_YERPP Glycogen debranching enzyme OS=Yersinia pestis (strain Pestoides F) GN=glgX PE=3 SV=1 165 340 2.0E-06
sp|Q1CDL4|GLGX_YERPN Glycogen debranching enzyme OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=glgX PE=3 SV=1 165 340 2.0E-06
sp|Q8ZA76|GLGX_YERPE Glycogen debranching enzyme OS=Yersinia pestis GN=glgX PE=3 SV=1 165 340 2.0E-06
sp|Q1C1E0|GLGX_YERPA Glycogen debranching enzyme OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=glgX PE=3 SV=1 165 340 2.0E-06
sp|B1JHX8|GLGX_YERPY Glycogen debranching enzyme OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=glgX PE=3 SV=1 165 340 2.0E-06
sp|Q664I3|GLGX_YERPS Glycogen debranching enzyme OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glgX PE=3 SV=1 165 340 2.0E-06
sp|Q8L735|ISOA2_ARATH Isoamylase 2, chloroplastic OS=Arabidopsis thaliana GN=ISA2 PE=1 SV=2 179 351 2.0E-06
sp|P9WQ25|GLGX_MYCTU Glycogen operon protein GlgX homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glgX PE=1 SV=1 170 352 3.0E-06
sp|P9WQ24|GLGX_MYCTO Glycogen operon protein GlgX homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glgX PE=3 SV=1 170 352 3.0E-06
sp|P0A4Y5|GLGX_MYCBO Glycogen operon protein GlgX homolog OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glgX PE=3 SV=1 170 352 3.0E-06
sp|C6DH78|GLGX_PECCP Glycogen debranching enzyme OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=glgX PE=3 SV=1 164 345 3.0E-06
sp|A8GKU9|GLGX_SERP5 Glycogen debranching enzyme OS=Serratia proteamaculans (strain 568) GN=glgX PE=3 SV=1 165 340 3.0E-06
sp|P14898|AMY2_DICT6 Alpha-amylase 2 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyB PE=1 SV=2 207 343 3.0E-06
sp|A7MGF3|GLGX_CROS8 Glycogen debranching enzyme OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=glgX PE=3 SV=1 162 345 6.0E-06
sp|P07191|MAL2_DROME Maltase A2 OS=Drosophila melanogaster GN=Mal-A2 PE=2 SV=2 196 356 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0043169 cation binding Yes
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|067100
MPTPPLDPAKVLEIDGYLRPHIPSIIQRYNRFRQWKNTIEQHEGGYDSFTRGYEKFGFHVGPNNEVVYREWAPNA
KEAYLIGEFNDWSRTSHPMKVNDFGVWEISIPPLPSGQCAIPHDSKIKLSMVLPSGERIERVPAWIRRVTQDLKV
SPVYDARFWNPPKSERYTFKNSRPPKPDNIRVYEAHVGISTSEARVGTYKEFTQNTLPRIKDLGYNTIQLMAIME
HAYYASFGYQVTSFFAASSRYGTPEDLKELIDTAHGLGLTVLLDIVHSHACKNVLDGLNEFDGTDHLYFHEGGKG
RHDLWDSRLFNYNSHEVLRFLLSNLRYWMDVYNFDGFRFDGVTSMMYKHHGIGAGFSGGYHEYFGDAADEESIVY
LMLANDSTHELYPNAITIAEDVSGMPLLCKRVDEGGVGFDYRLSMAIPDSWIKLLKHKTDDEWDMGDIVYTLTNR
RHGEKSIAYCESHDQALVGDKTIAFWLMDKEMYTHMSDMSPMTPVVARGLSLHKMMRLITHSLGGEGYLNFEGNE
FGHPEWLDFPREGNGNSFHYARRQWNVVDDNLLRYKYLNNFDRAMNQTAAKYKWLESPQAFVSLKHEVDKMIVYE
RAGLLFIFNFHPKNSFTDYRVGVEEAGEYRVVLNSDEKTFGGFDNVKSDSVYVTTPMKWNERKNYLQVYIPSRTC
LVLGKK*
Coding >AgabiH97|067100
ATGCCGACTCCCCCGCTAGACCCTGCTAAAGTCCTTGAGATAGACGGTTATCTCAGGCCACACATTCCCTCTATC
ATCCAACGCTACAACCGTTTTAGACAATGGAAGAATACTATCGAGCAGCATGAAGGTGGTTATGACAGTTTCACT
CGCGGTTACGAAAAATTTGGATTCCATGTGGGTCCTAACAATGAGGTTGTTTACCGGGAATGGGCCCCCAATGCA
AAAGAAGCCTATCTCATCGGCGAATTCAATGATTGGAGCAGAACTTCCCATCCTATGAAAGTGAATGACTTTGGC
GTTTGGGAAATCTCGATCCCTCCTCTACCTTCTGGTCAATGTGCCATTCCTCACGATAGCAAAATCAAACTCTCC
ATGGTCCTACCGAGCGGTGAACGCATTGAACGTGTTCCTGCTTGGATAAGGCGGGTTACTCAAGACCTCAAGGTT
TCTCCCGTCTATGACGCCCGTTTTTGGAATCCACCAAAATCAGAGCGATACACTTTCAAAAATTCTCGTCCGCCT
AAGCCGGATAACATCAGGGTCTATGAAGCACATGTTGGTATATCTACCTCAGAAGCGAGGGTAGGGACCTACAAG
GAATTTACGCAAAACACCCTTCCGAGAATCAAAGATCTTGGATACAATACGATCCAACTTATGGCGATCATGGAA
CATGCTTATTACGCTTCATTTGGGTACCAAGTGACGAGCTTTTTTGCTGCCAGCTCGCGTTATGGAACGCCCGAG
GACTTGAAAGAGCTTATCGATACCGCTCATGGACTTGGTTTGACCGTCCTTTTGGATATTGTCCATTCGCACGCC
TGCAAGAACGTTCTTGACGGCTTGAACGAGTTCGATGGTACCGATCACCTTTACTTTCACGAGGGTGGAAAAGGT
CGTCATGACCTGTGGGACAGTCGCTTGTTCAACTATAACAGCCATGAAGTCCTTCGGTTCCTTCTCAGTAACCTG
CGATACTGGATGGATGTTTACAACTTTGACGGATTTAGGTTTGATGGTGTTACGAGTATGATGTATAAACACCAT
GGTATTGGTGCTGGATTTTCTGGTGGTTACCATGAATATTTTGGTGATGCTGCTGATGAAGAGAGTATCGTCTAC
CTCATGCTTGCAAATGATTCTACGCATGAATTGTATCCGAATGCGATTACCATCGCTGAGGACGTCTCCGGCATG
CCTCTTCTCTGCAAACGCGTCGATGAGGGTGGAGTGGGTTTCGACTATAGGCTATCCATGGCTATCCCCGACTCA
TGGATCAAACTTCTCAAACACAAGACTGACGATGAATGGGATATGGGTGATATCGTGTATACTCTCACGAATAGG
CGTCATGGAGAGAAGAGCATCGCCTATTGTGAGAGCCACGATCAGGCATTAGTAGGCGACAAGACTATCGCATTT
TGGTTGATGGATAAAGAGATGTATACACATATGTCCGATATGTCGCCCATGACGCCAGTTGTCGCTCGTGGCTTG
TCGTTGCATAAGATGATGAGACTCATCACCCATTCCCTTGGTGGAGAAGGCTATCTCAATTTCGAAGGGAACGAG
TTTGGCCATCCCGAGTGGCTTGACTTCCCTCGAGAAGGCAATGGCAACTCATTCCACTACGCACGTCGTCAATGG
AACGTCGTGGATGATAACCTTCTTCGCTACAAATACCTCAACAACTTCGATCGCGCGATGAATCAGACCGCAGCA
AAATATAAATGGCTCGAATCGCCCCAAGCTTTCGTTTCTCTCAAACACGAGGTCGACAAAATGATCGTATACGAA
CGTGCCGGATTGCTGTTTATCTTCAATTTCCATCCAAAAAATAGTTTCACGGATTATAGAGTTGGGGTTGAGGAA
GCTGGAGAATATAGGGTTGTGTTGAACAGTGATGAAAAGACTTTTGGAGGGTTTGACAATGTGAAGAGTGATTCG
GTGTATGTTACTACGCCGATGAAGTGGAATGAGAGGAAAAATTACTTGCAGGTGTATATCCCCTCAAGAACCTGT
CTTGTCCTCGGTAAAAAATAA
Transcript >AgabiH97|067100
ATGCCGACTCCCCCGCTAGACCCTGCTAAAGTCCTTGAGATAGACGGTTATCTCAGGCCACACATTCCCTCTATC
ATCCAACGCTACAACCGTTTTAGACAATGGAAGAATACTATCGAGCAGCATGAAGGTGGTTATGACAGTTTCACT
CGCGGTTACGAAAAATTTGGATTCCATGTGGGTCCTAACAATGAGGTTGTTTACCGGGAATGGGCCCCCAATGCA
AAAGAAGCCTATCTCATCGGCGAATTCAATGATTGGAGCAGAACTTCCCATCCTATGAAAGTGAATGACTTTGGC
GTTTGGGAAATCTCGATCCCTCCTCTACCTTCTGGTCAATGTGCCATTCCTCACGATAGCAAAATCAAACTCTCC
ATGGTCCTACCGAGCGGTGAACGCATTGAACGTGTTCCTGCTTGGATAAGGCGGGTTACTCAAGACCTCAAGGTT
TCTCCCGTCTATGACGCCCGTTTTTGGAATCCACCAAAATCAGAGCGATACACTTTCAAAAATTCTCGTCCGCCT
AAGCCGGATAACATCAGGGTCTATGAAGCACATGTTGGTATATCTACCTCAGAAGCGAGGGTAGGGACCTACAAG
GAATTTACGCAAAACACCCTTCCGAGAATCAAAGATCTTGGATACAATACGATCCAACTTATGGCGATCATGGAA
CATGCTTATTACGCTTCATTTGGGTACCAAGTGACGAGCTTTTTTGCTGCCAGCTCGCGTTATGGAACGCCCGAG
GACTTGAAAGAGCTTATCGATACCGCTCATGGACTTGGTTTGACCGTCCTTTTGGATATTGTCCATTCGCACGCC
TGCAAGAACGTTCTTGACGGCTTGAACGAGTTCGATGGTACCGATCACCTTTACTTTCACGAGGGTGGAAAAGGT
CGTCATGACCTGTGGGACAGTCGCTTGTTCAACTATAACAGCCATGAAGTCCTTCGGTTCCTTCTCAGTAACCTG
CGATACTGGATGGATGTTTACAACTTTGACGGATTTAGGTTTGATGGTGTTACGAGTATGATGTATAAACACCAT
GGTATTGGTGCTGGATTTTCTGGTGGTTACCATGAATATTTTGGTGATGCTGCTGATGAAGAGAGTATCGTCTAC
CTCATGCTTGCAAATGATTCTACGCATGAATTGTATCCGAATGCGATTACCATCGCTGAGGACGTCTCCGGCATG
CCTCTTCTCTGCAAACGCGTCGATGAGGGTGGAGTGGGTTTCGACTATAGGCTATCCATGGCTATCCCCGACTCA
TGGATCAAACTTCTCAAACACAAGACTGACGATGAATGGGATATGGGTGATATCGTGTATACTCTCACGAATAGG
CGTCATGGAGAGAAGAGCATCGCCTATTGTGAGAGCCACGATCAGGCATTAGTAGGCGACAAGACTATCGCATTT
TGGTTGATGGATAAAGAGATGTATACACATATGTCCGATATGTCGCCCATGACGCCAGTTGTCGCTCGTGGCTTG
TCGTTGCATAAGATGATGAGACTCATCACCCATTCCCTTGGTGGAGAAGGCTATCTCAATTTCGAAGGGAACGAG
TTTGGCCATCCCGAGTGGCTTGACTTCCCTCGAGAAGGCAATGGCAACTCATTCCACTACGCACGTCGTCAATGG
AACGTCGTGGATGATAACCTTCTTCGCTACAAATACCTCAACAACTTCGATCGCGCGATGAATCAGACCGCAGCA
AAATATAAATGGCTCGAATCGCCCCAAGCTTTCGTTTCTCTCAAACACGAGGTCGACAAAATGATCGTATACGAA
CGTGCCGGATTGCTGTTTATCTTCAATTTCCATCCAAAAAATAGTTTCACGGATTATAGAGTTGGGGTTGAGGAA
GCTGGAGAATATAGGGTTGTGTTGAACAGTGATGAAAAGACTTTTGGAGGGTTTGACAATGTGAAGAGTGATTCG
GTGTATGTTACTACGCCGATGAAGTGGAATGAGAGGAAAAATTACTTGCAGGTGTATATCCCCTCAAGAACCTGT
CTTGTCCTCGGTAAAAAATAA
Gene >AgabiH97|067100
ATGCCGACTCCCCCGCTAGACCCTGCTAAAGTCCTTGAGATAGACGGTTATCTCAGGCCACACATTCCCTCTATC
ATCCAACGCTACAACCGTTTTAGACAATGGAAGAATACTATCGAGCAGCATGAAGGTGGTTATGACAGTTTCACT
CGCGGTTACGAAAAATTTGGATTCCATGTGGGTCCTAACAATGAGGTTGTTTACCGGGAATGGGCCCCCAATGCA
AAAGAAGCCTATCTCATCGGCGAATTCAGTCAGTGTCTTATATTTTCCTAATTGTTGTGTCTTCATTGATTAAGA
ATAGATGATTGGAGCAGAACTTCCCATCCTATGAAAGTGAATGACTTTGGCGTTTGGGAAATCTCGATCCCTCCT
CTACCTTCTGGTCAATGTGCCATTCCTCACGATAGCAAAATCAAAGTACGTGTCTCATACAAGGGATCTAAGTCT
TTTGTGTTGAATAATCGCTAGCTCTCCATGGTCCTACCGAGCGGTGAACGCATTGAACGTGTTCCTGCTTGGATA
AGGCGGGTTACTCAAGACCTCAAGGTTTCTCCCGTCTATGACGCCCGTTTTTGGAATCCACCAAAATCAGAGCGA
TACACTTTCAAAAATTCTCGTCCGCCTAAGCCGGATAACATCAGGGTCTATGAAGCACATGTTGGTATATCTACC
TCAGAAGCGAGGGTAGGGACCTACAAGGAATTTACGCAAAACACCCTTCCGAGAATCAAAGATCTTGGATACAAT
ACGATCCAACTTATGGCGATCATGGAACATGCTTATTACGCTTGTGAGAGCAATTATTTATGTGTTCTTTTTTGA
CCGTGTGTTGATATATGCTCGACAGCATTTGGGTACCAAGTGACGAGCTTTTTTGCTGCCAGCTCGCGTTATGGA
ACGCCCGAGGACTTGAAAGAGCTTATCGATACCGCTCATGGACTTGGTTTGACCGTCCTTTTGGATATTGTCCAT
TCGCACGCCTGCAAGAACGTTCTTGACGGCTTGAACGAGTTCGATGGTACCGATCACCTTTACTTTCACGAGGGT
GGAAAAGGTCGTCATGACCTGTGGGACAGTCGCTTGTTCAACTATAACAGCCATGAAGTCCTTCGGTTCCTTCTC
AGTAACCTGCGATACTGGATGGATGTTTACAACTTTGACGGATTTAGGTTTGATGGTGTTACGAGTATGATGTAT
AAACACCATGGTATTGGTGCTGGATTTTCTGGTGGTTACCATGAATATTTTGGTGATGCTGCTGATGAAGAGAGT
ATCGTCTACCTCATGCTTGTGAGCCTTCACTTTCTCAAAAGTTTAGTTGTGCCTTATCATCTGCCCTAGGCAAAT
GATTCTACGCATGAATTGTATCCGAATGCGATTACCATCGCTGAGGACGTCTCCGGCATGCCTCTTCTCTGCAAA
CGCGTCGATGAGGGTGGAGTGGGTTTCGACTATAGGCTATCCATGGCTATCCCCGACTCATGGATCAAACTTCTC
AAACACAAGACTGACGATGAATGGGATATGGGTGATATCGTGTATACTCTCACGAATAGGCGTCATGGAGAGAAG
AGCATCGCCTATTGTGAGAGCCACGATCAGGCATTAGTAGGCGACAAGACTATCGCATTTTGGTTGATGGATAAA
GAGATGTGTAATGTCGATTTCTTTTTCATATTTTCGATACCAGGGCTGACATTATTCTCCAATAGATACACATAT
GTCCGATATGTCGCCCATGACGCCAGTTGTCGCTCGTGGCTTGTCGTTGCATAAGATGATGAGACTCATCACCCA
TTCCCTTGGTGGAGAAGGCTATCTCAATTTCGAAGGGAACGAGTTTGGCCATCCCGAGGTCTGTTGATTCATCTC
CCATGCTACTTCCACCTATTCAACCATTGAATCAGTGGCTTGACTTCCCTCGAGAAGGCAATGGCAACTCATTCC
ACTACGCACGTCGTCAATGGAACGTCGTGGATGATAACCTTCTTCGCTACAAATACCTCAACAACTTCGATCGCG
CGATGAATCAGACCGCAGCAAAATATAAATGGCTCGAATCGCCCCAAGCTTTCGTTTCTCTCAAACACGAGGTCG
ACAAAATGATCGTATACGAACGTGCCGGATTGCTGTTTATCTTCAATTTCCATCCAAAAAATAGTTTCACGGATT
ATAGAGTTGGGGTTGAGGAAGCTGGAGAATATAGGGTTGTGTTGAACAGTGATGAAAAGACTTTTGGAGGGTTTG
ACAATGTGAAGAGTGATTCGGTGTATGTTACTACGCCGATGAAGTGGAATGAGAGGAAAAATTACTTGCAGGTGA
GTATCGTCGTTGCTGTGAGTTGTATCTGAGCTGACAGGCTGTGTCATTGTTAGGTGTATATCCCCTCAAGAACCT
GTCTTGTCCTCGGTAAAAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail