Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|066820
Gene name
Locationscaffold_4:367037..368632
Strand+
Gene length (bp)1595
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09350 DJC28_CD DnaJ homologue, subfamily C, member 28, conserved domain 6.9E-20 264 333

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|066820
MRSIRITIQCTRFPYLKPHSRLSSTKASDKLFADAALEEEESSKGTDNKTKSQTLNLLGQEDENWTGDERIQDAV
LRMLVDKYKPLRGSRIVTAEEKLKQAPPKVLSSSSSTSTSYPIPSSSTFSSSPALSSSPGEPSVTGFMKPRSGSW
ATEPLLPSIEGHKPWETKFKAPSHDGPVNIKLGNLVSSSTSRPGLGGVGGLSGSALLDERLVKKEKEKMKKEQQA
GRLSQALESTLDYRLGIKSGKGPTGRPNPVSMKGWNSFIEERIEKARLAGVFKNVKGRGQPLLRSIDETNPFIAR
EEFLMNRIVQQNGAAPPWVEIQGELETAARTFREILHQSWVRRAIRILTTNNPVEFLHKITFDEVKALRDPDWIK
KEQSYHDTAIAELNSLVRKYNGLAPHAVRKSYYYTREGEIDRMYEASAKDVMKELEERLRDPGFIGNTNEGARGG
SRGPVGSSNAREGAVPPVEENQPQPSWRITDLIREWINSMRSWRAR*
Coding >AgabiH97|066820
ATGCGATCAATCAGAATCACAATTCAGTGCACCCGTTTTCCATATCTTAAACCCCACAGCAGGCTATCCAGTACT
AAAGCAAGTGACAAACTCTTCGCTGATGCCGCGCTCGAAGAAGAGGAATCCTCCAAAGGGACGGACAACAAAACT
AAATCTCAAACCCTCAATTTGCTAGGACAAGAGGATGAAAATTGGACAGGGGATGAACGTATTCAGGATGCTGTC
CTTCGAATGCTTGTCGACAAATACAAACCACTTCGTGGATCGAGGATTGTTACGGCGGAAGAGAAGCTTAAACAG
GCTCCTCCGAAAGTTCTGTCCTCGTCTAGTTCAACTTCAACTTCATATCCAATACCTTCCTCATCAACATTCTCA
TCTTCACCTGCACTTTCGTCGTCTCCCGGGGAGCCCTCTGTTACCGGATTTATGAAACCTCGTTCAGGATCATGG
GCCACTGAACCTCTATTGCCTTCAATTGAAGGACACAAACCCTGGGAAACGAAATTCAAAGCTCCATCCCATGAC
GGACCTGTGAATATCAAACTAGGGAATCTAGTATCGTCTTCGACTTCAAGACCCGGACTAGGTGGTGTAGGCGGA
TTAAGTGGATCAGCCTTGTTGGATGAAAGACTCGTAAAGAAGGAAAAAGAAAAGATGAAGAAGGAACAACAAGCT
GGGAGGTTAAGTCAAGCATTGGAGTCGACTTTAGATTATAGACTCGGAATTAAAAGTGGGAAAGGACCGACGGGA
AGACCGAATCCTGTTAGTATGAAAGGGTGGAATAGTTTTATTGAGGAACGCATTGAGAAAGCTCGTCTTGCTGGA
GTATTCAAGAATGTGAAAGGTCGAGGTCAACCACTCTTACGCTCGATTGATGAAACGAATCCTTTTATCGCTCGG
GAAGAGTTTCTCATGAACCGTATTGTGCAACAGAATGGTGCTGCTCCTCCTTGGGTAGAGATTCAGGGCGAGCTT
GAGACAGCTGCAAGAACATTCCGCGAGATATTACATCAATCATGGGTCCGACGCGCAATACGAATATTAACCACC
AACAACCCTGTGGAATTCCTTCACAAAATCACTTTTGACGAAGTCAAAGCTCTGCGAGACCCTGATTGGATAAAG
AAGGAACAGTCATATCATGACACCGCCATCGCTGAGTTAAACTCACTTGTACGCAAATACAATGGCTTGGCGCCC
CATGCTGTTCGAAAATCGTACTATTACACGAGAGAAGGCGAGATTGATAGGATGTATGAAGCGTCTGCGAAAGAT
GTTATGAAAGAGTTGGAAGAGCGGCTCCGAGATCCTGGGTTCATTGGTAACACCAACGAAGGCGCTAGAGGTGGT
TCTCGTGGTCCTGTTGGTTCATCAAATGCTCGAGAAGGTGCAGTACCACCTGTCGAGGAAAACCAGCCACAACCT
TCATGGCGGATTACTGACCTGATACGAGAATGGATTAATAGTATGAGATCATGGAGGGCCAGGTAG
Transcript >AgabiH97|066820
ATGCGATCAATCAGAATCACAATTCAGTGCACCCGTTTTCCATATCTTAAACCCCACAGCAGGCTATCCAGTACT
AAAGCAAGTGACAAACTCTTCGCTGATGCCGCGCTCGAAGAAGAGGAATCCTCCAAAGGGACGGACAACAAAACT
AAATCTCAAACCCTCAATTTGCTAGGACAAGAGGATGAAAATTGGACAGGGGATGAACGTATTCAGGATGCTGTC
CTTCGAATGCTTGTCGACAAATACAAACCACTTCGTGGATCGAGGATTGTTACGGCGGAAGAGAAGCTTAAACAG
GCTCCTCCGAAAGTTCTGTCCTCGTCTAGTTCAACTTCAACTTCATATCCAATACCTTCCTCATCAACATTCTCA
TCTTCACCTGCACTTTCGTCGTCTCCCGGGGAGCCCTCTGTTACCGGATTTATGAAACCTCGTTCAGGATCATGG
GCCACTGAACCTCTATTGCCTTCAATTGAAGGACACAAACCCTGGGAAACGAAATTCAAAGCTCCATCCCATGAC
GGACCTGTGAATATCAAACTAGGGAATCTAGTATCGTCTTCGACTTCAAGACCCGGACTAGGTGGTGTAGGCGGA
TTAAGTGGATCAGCCTTGTTGGATGAAAGACTCGTAAAGAAGGAAAAAGAAAAGATGAAGAAGGAACAACAAGCT
GGGAGGTTAAGTCAAGCATTGGAGTCGACTTTAGATTATAGACTCGGAATTAAAAGTGGGAAAGGACCGACGGGA
AGACCGAATCCTGTTAGTATGAAAGGGTGGAATAGTTTTATTGAGGAACGCATTGAGAAAGCTCGTCTTGCTGGA
GTATTCAAGAATGTGAAAGGTCGAGGTCAACCACTCTTACGCTCGATTGATGAAACGAATCCTTTTATCGCTCGG
GAAGAGTTTCTCATGAACCGTATTGTGCAACAGAATGGTGCTGCTCCTCCTTGGGTAGAGATTCAGGGCGAGCTT
GAGACAGCTGCAAGAACATTCCGCGAGATATTACATCAATCATGGGTCCGACGCGCAATACGAATATTAACCACC
AACAACCCTGTGGAATTCCTTCACAAAATCACTTTTGACGAAGTCAAAGCTCTGCGAGACCCTGATTGGATAAAG
AAGGAACAGTCATATCATGACACCGCCATCGCTGAGTTAAACTCACTTGTACGCAAATACAATGGCTTGGCGCCC
CATGCTGTTCGAAAATCGTACTATTACACGAGAGAAGGCGAGATTGATAGGATGTATGAAGCGTCTGCGAAAGAT
GTTATGAAAGAGTTGGAAGAGCGGCTCCGAGATCCTGGGTTCATTGGTAACACCAACGAAGGCGCTAGAGGTGGT
TCTCGTGGTCCTGTTGGTTCATCAAATGCTCGAGAAGGTGCAGTACCACCTGTCGAGGAAAACCAGCCACAACCT
TCATGGCGGATTACTGACCTGATACGAGAATGGATTAATAGTATGAGATCATGGAGGGCCAGGTAG
Gene >AgabiH97|066820
ATGCGATCAATCAGAATCACAATTCAGTGCACCCGTTTTCCATATCTTAAACCCCACAGCAGGCTATCCAGTACT
AAAGCAAGTGACAAACTCTTCGCTGATGCCGCGCTCGAAGAAGAGGAATCCTCCAAAGGGACGGACAACAAAACT
AAATCTCAAACCCTCAATTTGCTAGGACAAGAGGATGAAAATTGGACAGGGGATGAACGTATTCAGGATGCTGTC
CTTCGAATGCTTGTCGACAAATACAAACCACTTCGTGGATCGAGGATTGTTACGGCGGAAGAGAAGCTTAAACAG
GCTCCTCCGAAAGTTCTGTCCTCGTCTAGTTCAACTTCAACTTCATATCCAATACCTTCCTCATCAACATTCTCA
TCTTCACCTGCACTTTCGTCGTCTCCCGGGGAGCCCTCTGTTACCGGATTTATGAAACCTCGTTCAGGATCATGG
GCCACTGAACCTCTATTGCCTTCAATTGAAGGACACAAACCCTGGGAAACGAAATTCAAAGCTCCATCCCATGAC
GGACCTGTGAATATCAAACTAGGGAATCTAGTATCGTCTTCGACTTCAAGACCCGGACTAGGTGGTGTAGGCGGA
TTAAGTGGATCAGCCTTGTTGGATGAAAGACTCGTAAAGAAGGAAAAAGAAAAGATGAAGAAGGAACAACAAGCT
GGGAGGTTAAGTCAAGCATTGGAGTCGACTTTAGATTATAGACTCGGAATTAAAAGTGGGAAAGGACCGACGGGA
AGACCGAATCCTGTTAGTATGAAAGGGTGGAATAGTTTTATTGAGGAACGCATTGAGGTAAGTCTTTCCGGTAGA
TGGAGAATTGCGCGTTGTATGGCTGAAGCTTTCTTAGAAAGCTCGTCTTGCTGGAGTATTCAAGAATGTGAAAGG
TCGAGGTCAACCACTCTTACGCTCGATTGATGAAACGAATCCTTTTATCGCTCGGGAAGAGTTTCTCATGAACCG
TATTGTGCAACAGAATGGTGCTGCTCCTCCTTGGGTAGAGATTCAGGGCGGTAGGTCATCGCGGCTCCAGCCAAC
ACCCACCTTTCTGATTGCTTTCAGAGCTTGAGACAGCTGCAAGAACATTCCGCGAGATATTACATCAATCATGGG
TCCGACGCGCAATACGAATATTAACCACCAACAACCCTGTGGAATTCCTTCACAAAATCACTTTTGACGAAGTCA
AAGCTCTGCGAGACCCTGATTGGATAAAGAAGGAACAGTCATATCATGACACCGCCATCGCTGAGTTAAACTCAC
TTGTACGCAAATACAATGGCTTGGCGCCCCATGCTGTTCGAAAATCGTACTATTACACGAGAGAAGGCGAGATTG
ATAGGATGTATGAAGCGTCTGCGAAAGATGTTATGAAAGAGTTGGAAGAGCGGCTCCGAGATCCTGGGTTCATTG
GTAACACCAACGAAGGCGCTAGAGGTGGTTCTCGTGGTCCTGTTGGTTCATCAAATGCTCGAGAAGGTGCAGTAC
CACCTGTCGAGGAAAACCAGCCACAACCTTCATGGCGGATTACTGACCTGATACGAGAATGGATTAATAGTATGA
GATCATGGAGGGCCAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail