Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|066530
Gene name
Locationscaffold_4:277827..279372
Strand-
Gene length (bp)1545
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW3|YHZ7_SCHPO Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.07 PE=3 SV=1 18 324 4.0E-48
sp|A1DHY9|EGLX_NEOFI Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_089530 PE=3 SV=1 3 324 3.0E-46
sp|Q4X084|EGLX_ASPFU Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14360 PE=3 SV=1 22 324 2.0E-45
sp|B0XTU6|EGLX_ASPFC Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_029980 PE=3 SV=1 22 324 2.0E-45
sp|Q2UIE6|EGLX_ASPOR Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090023000083 PE=3 SV=1 16 324 7.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW3|YHZ7_SCHPO Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.07 PE=3 SV=1 18 324 4.0E-48
sp|A1DHY9|EGLX_NEOFI Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_089530 PE=3 SV=1 3 324 3.0E-46
sp|Q4X084|EGLX_ASPFU Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14360 PE=3 SV=1 22 324 2.0E-45
sp|B0XTU6|EGLX_ASPFC Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_029980 PE=3 SV=1 22 324 2.0E-45
sp|Q2UIE6|EGLX_ASPOR Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090023000083 PE=3 SV=1 16 324 7.0E-45
sp|A1C7B5|EGLX_ASPCL Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_073210 PE=3 SV=1 22 337 7.0E-45
sp|Q5BAP5|EGLX_EMENI Endo-1,3(4)-beta-glucanase xgeA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xgeA PE=3 SV=1 21 326 8.0E-44
sp|A2QBQ3|EGLX_ASPNC Probable endo-1,3(4)-beta-glucanase An02g00850 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g00850 PE=3 SV=1 20 324 8.0E-43
sp|B8N7S7|EGLX_ASPFN Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_105200 PE=3 SV=1 16 324 4.0E-42
sp|D4AJR9|EGLX_ARTBC Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04519 PE=3 SV=1 22 380 7.0E-41
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 12.40 6.13 18.68
Initials Initials knots 14.54 7.42 21.66
Pileal_Stipeal_center Stage I stipe center 44.45 25.59 63.32
Pileal_Stipeal_shell Stage I stipe shell 14.12 7.07 21.17
DIF_stipe_center Stage II stipe center 21.22 11.27 31.18
DIF_stipe_shell Stage II stipe shell 37.68 21.35 54.01
DIF_stipe_skin Stage II stipe skin 54.52 32.18 76.85
DIF_cap_skin Stage II cap skin 22.42 11.83 33.01
DIF_cap_tissue Stage II cap tissue 18.23 9.55 26.91
DIF_gill_tissue Stage II gill tissue 15.29 7.81 22.76
YFB_stipe_center Young fruiting body stipe center 20.36 10.43 30.29
YFB_stipe_shell Young fruiting body stipe shell 22.11 11.71 32.51
YFB_stipe_skin Young fruiting body stipe skin 80.54 47.07 114.02
YFB_cap_skin Young fruiting body cap skin 21.10 11.30 30.91
YFB_cap_tissue Young fruiting body cap tissue 9.43 4.35 14.52
YFB_gill_tissue Young fruiting body gill tissue 23.80 12.90 34.70
YFB_veil Young fruiting body veil 20.70 10.33 31.07

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.661576 no
Casing YFB_stipe_center 0.170099 no
Casing YFB_stipe_shell 0.087416 no
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.115194 no
Casing YFB_cap_tissue 0.555668 no
Casing YFB_gill_tissue 0.044631 yes
Casing YFB_veil 0.156911 no
Casing Initials 0.765672 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.823219 no
Casing DIF_stipe_center 0.115346 no
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.076626 no
Casing DIF_cap_tissue 0.313535 no
DIF_gill_tissue YFB_stipe_center 0.509833 no
DIF_gill_tissue YFB_stipe_shell 0.336597 no
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.406687 no
DIF_gill_tissue YFB_cap_tissue 0.201872 no
DIF_gill_tissue YFB_gill_tissue 0.209844 no
DIF_gill_tissue YFB_veil 0.484594 no
YFB_stipe_center YFB_stipe_shell 0.889900 no
YFB_stipe_center YFB_stipe_skin 0.000613 yes
YFB_stipe_center YFB_cap_skin 0.955643 no
YFB_stipe_center YFB_cap_tissue 0.026955 yes
YFB_stipe_center YFB_gill_tissue 0.756891 no
YFB_stipe_center YFB_veil 0.980275 no
YFB_stipe_shell YFB_stipe_skin 0.000613 yes
YFB_stipe_shell YFB_cap_skin 0.940004 no
YFB_stipe_shell YFB_cap_tissue 0.010728 yes
YFB_stipe_shell YFB_gill_tissue 0.902876 no
YFB_stipe_shell YFB_veil 0.917520 no
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.015819 yes
YFB_cap_skin YFB_gill_tissue 0.819731 no
YFB_cap_skin YFB_veil 0.975945 no
YFB_cap_tissue YFB_gill_tissue 0.006032 yes
YFB_cap_tissue YFB_veil 0.021322 yes
YFB_gill_tissue YFB_veil 0.798548 no
Initials DIF_gill_tissue 0.937016 no
Initials YFB_stipe_center 0.410792 no
Initials YFB_stipe_shell 0.252288 no
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.314071 no
Initials YFB_cap_tissue 0.269957 no
Initials YFB_gill_tissue 0.149754 no
Initials YFB_veil 0.387685 no
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.965710 no
Initials DIF_stipe_center 0.322692 no
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.230438 no
Initials DIF_cap_tissue 0.617510 no
Pileal_Stipeal_center DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_stipe_center 0.006387 yes
Pileal_Stipeal_center YFB_stipe_shell 0.018066 yes
Pileal_Stipeal_center YFB_stipe_skin 0.032266 yes
Pileal_Stipeal_center YFB_cap_skin 0.007439 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.039836 yes
Pileal_Stipeal_center YFB_veil 0.010412 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.009773 yes
Pileal_Stipeal_center DIF_stipe_shell 0.711929 no
Pileal_Stipeal_center DIF_stipe_skin 0.598330 no
Pileal_Stipeal_center DIF_cap_skin 0.020523 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.897344 no
Pileal_Stipeal_shell YFB_stipe_center 0.363294 no
Pileal_Stipeal_shell YFB_stipe_shell 0.217311 no
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.271949 no
Pileal_Stipeal_shell YFB_cap_tissue 0.323512 no
Pileal_Stipeal_shell YFB_gill_tissue 0.124703 no
Pileal_Stipeal_shell YFB_veil 0.341051 no
Pileal_Stipeal_shell DIF_stipe_center 0.279565 no
Pileal_Stipeal_shell DIF_stipe_shell 0.002084 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.199869 no
Pileal_Stipeal_shell DIF_cap_tissue 0.567950 no
DIF_stipe_center DIF_gill_tissue 0.413939 no
DIF_stipe_center YFB_stipe_center 0.949141 no
DIF_stipe_center YFB_stipe_shell 0.947526 no
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.992628 no
DIF_stipe_center YFB_cap_tissue 0.016386 yes
DIF_stipe_center YFB_gill_tissue 0.836375 no
DIF_stipe_center YFB_veil 0.969315 no
DIF_stipe_center DIF_stipe_shell 0.069387 no
DIF_stipe_center DIF_stipe_skin 0.001625 yes
DIF_stipe_center DIF_cap_skin 0.927766 no
DIF_stipe_center DIF_cap_tissue 0.767164 no
DIF_stipe_shell DIF_gill_tissue 0.001625 yes
DIF_stipe_shell YFB_stipe_center 0.051723 no
DIF_stipe_shell YFB_stipe_shell 0.093997 no
DIF_stipe_shell YFB_stipe_skin 0.002084 yes
DIF_stipe_shell YFB_cap_skin 0.052135 no
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.160518 no
DIF_stipe_shell YFB_veil 0.060892 no
DIF_stipe_shell DIF_stipe_skin 0.239320 no
DIF_stipe_shell DIF_cap_skin 0.104587 no
DIF_stipe_shell DIF_cap_tissue 0.010412 yes
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.000613 yes
DIF_stipe_skin YFB_stipe_shell 0.002084 yes
DIF_stipe_skin YFB_stipe_skin 0.188160 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.001625 yes
DIF_stipe_skin YFB_veil 0.001140 yes
DIF_stipe_skin DIF_cap_skin 0.001140 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.305777 no
DIF_cap_skin YFB_stipe_center 0.870336 no
DIF_cap_skin YFB_stipe_shell 0.982643 no
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.919711 no
DIF_cap_skin YFB_cap_tissue 0.010728 yes
DIF_cap_skin YFB_gill_tissue 0.922587 no
DIF_cap_skin YFB_veil 0.897695 no
DIF_cap_skin DIF_cap_tissue 0.651202 no
DIF_cap_tissue DIF_gill_tissue 0.719950 no
DIF_cap_tissue YFB_stipe_center 0.846991 no
DIF_cap_tissue YFB_stipe_shell 0.682222 no
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.767889 no
DIF_cap_tissue YFB_cap_tissue 0.056367 no
DIF_cap_tissue YFB_gill_tissue 0.519343 no
DIF_cap_tissue YFB_veil 0.821957 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|066530
MCYISVRRLLGYWLWLSPSVASAAYAPLREYAGSNFFDGWDYYGFHDNTTWGNVTYVDRQTAMSSRLTYVNGAGN
AVVKVDNTSFIQNGPLVYRNSVRITSQEVYGIGSLIIIDVRHIPYGCSVWPAFWTLGSGKTWPQGGEIDIIESIN
LLPNNQIALHTTPGCSQSQNLGQTGQTTEGDCSTPQGCVVRETKANSYESGFAQAGGGVWATQIDASGIFIWFWS
RPDVPENIKTSNNASYIDTVPWGIPTASYPADGCNISQYFTPQNLILLTTLCGNWAGVPGIYDSTCHTPTMSCAV
DNVVGPGSPTYDQAYWEISWIRTYTLALPGQPTTITSSDPPVQDASSMTVSRGATTSTMQATSAALTPGPTVSSA
VSSTLPTTSCVFGSVLLVAMLGNLMLR*
Coding >AgabiH97|066530
ATGTGCTACATAAGCGTCCGCCGTCTCCTAGGCTACTGGTTGTGGTTGAGCCCAAGCGTCGCATCGGCGGCCTAC
GCGCCACTTCGTGAATACGCCGGATCGAATTTCTTTGACGGCTGGGACTATTATGGCTTCCACGATAACACGACG
TGGGGTAATGTCACTTATGTAGATAGACAGACAGCAATGTCAAGTCGTCTCACCTATGTCAATGGTGCCGGAAAT
GCTGTCGTGAAAGTCGATAACACCTCATTTATCCAGAATGGTCCATTAGTTTATAGAAACTCGGTACGCATCACA
TCGCAGGAAGTATACGGTATCGGGTCCTTAATTATAATCGACGTTCGACACATTCCATATGGGTGTTCTGTGTGG
CCCGCCTTCTGGACTCTTGGCTCTGGTAAAACTTGGCCGCAAGGGGGCGAAATCGACATCATTGAAAGTATCAAC
TTACTTCCCAACAACCAAATCGCGTTACACACCACGCCCGGCTGCTCTCAATCTCAGAATCTAGGACAGACAGGT
CAAACTACCGAAGGAGATTGTTCTACTCCTCAGGGGTGCGTTGTACGAGAGACGAAAGCGAACAGCTACGAGTCC
GGATTTGCTCAGGCTGGGGGAGGTGTATGGGCTACACAAATCGACGCCTCTGGTATTTTTATTTGGTTTTGGAGT
AGACCTGATGTCCCGGAGAATATTAAAACATCTAATAATGCCTCATATATTGATACGGTGCCGTGGGGGATACCT
ACTGCTTCATATCCAGCTGATGGTTGCAACATCTCGCAATATTTCACCCCTCAAAACCTCATATTACTTACCACG
CTGTGTGGAAATTGGGCAGGTGTCCCAGGCATCTACGACAGTACTTGCCATACGCCCACAATGTCTTGTGCTGTG
GATAATGTAGTCGGTCCTGGAAGTCCGACGTATGATCAAGCATACTGGGAGATTTCCTGGATACGAACTTATACC
CTGGCTCTTCCTGGCCAACCTACCACTATTACATCGAGTGATCCGCCTGTGCAGGACGCTTCGTCCATGACAGTA
TCACGAGGGGCGACCACTAGTACTATGCAAGCCACATCTGCGGCTCTGACACCCGGACCCACAGTTTCTTCCGCC
GTGTCCAGTACTTTGCCTACGACTTCGTGTGTGTTTGGGAGTGTTCTACTTGTTGCGATGCTTGGTAACCTGATG
CTACGATGA
Transcript >AgabiH97|066530
ATGTGCTACATAAGCGTCCGCCGTCTCCTAGGCTACTGGTTGTGGTTGAGCCCAAGCGTCGCATCGGCGGCCTAC
GCGCCACTTCGTGAATACGCCGGATCGAATTTCTTTGACGGCTGGGACTATTATGGCTTCCACGATAACACGACG
TGGGGTAATGTCACTTATGTAGATAGACAGACAGCAATGTCAAGTCGTCTCACCTATGTCAATGGTGCCGGAAAT
GCTGTCGTGAAAGTCGATAACACCTCATTTATCCAGAATGGTCCATTAGTTTATAGAAACTCGGTACGCATCACA
TCGCAGGAAGTATACGGTATCGGGTCCTTAATTATAATCGACGTTCGACACATTCCATATGGGTGTTCTGTGTGG
CCCGCCTTCTGGACTCTTGGCTCTGGTAAAACTTGGCCGCAAGGGGGCGAAATCGACATCATTGAAAGTATCAAC
TTACTTCCCAACAACCAAATCGCGTTACACACCACGCCCGGCTGCTCTCAATCTCAGAATCTAGGACAGACAGGT
CAAACTACCGAAGGAGATTGTTCTACTCCTCAGGGGTGCGTTGTACGAGAGACGAAAGCGAACAGCTACGAGTCC
GGATTTGCTCAGGCTGGGGGAGGTGTATGGGCTACACAAATCGACGCCTCTGGTATTTTTATTTGGTTTTGGAGT
AGACCTGATGTCCCGGAGAATATTAAAACATCTAATAATGCCTCATATATTGATACGGTGCCGTGGGGGATACCT
ACTGCTTCATATCCAGCTGATGGTTGCAACATCTCGCAATATTTCACCCCTCAAAACCTCATATTACTTACCACG
CTGTGTGGAAATTGGGCAGGTGTCCCAGGCATCTACGACAGTACTTGCCATACGCCCACAATGTCTTGTGCTGTG
GATAATGTAGTCGGTCCTGGAAGTCCGACGTATGATCAAGCATACTGGGAGATTTCCTGGATACGAACTTATACC
CTGGCTCTTCCTGGCCAACCTACCACTATTACATCGAGTGATCCGCCTGTGCAGGACGCTTCGTCCATGACAGTA
TCACGAGGGGCGACCACTAGTACTATGCAAGCCACATCTGCGGCTCTGACACCCGGACCCACAGTTTCTTCCGCC
GTGTCCAGTACTTTGCCTACGACTTCGTGTGTGTTTGGGAGTGTTCTACTTGTTGCGATGCTTGGTAACCTGATG
CTACGATGA
Gene >AgabiH97|066530
ATGTGCTACATAAGCGTCCGCCGTCTCCTAGGCTACTGGTTGTGGTTGAGCCCAAGCGTCGCATCGGCGGCCTAC
GCGCCACTTCGTGAATACGCCGGATCGAATTTCTTTGACGGCTGGGACTATTATGGCTTCCACGATAACACGACG
TGGGGTACGTATCATCGGAGTAATTTTTTCTGCCACACGTATACTGACATTCTGCGAATAATCTAGGTAATGTCA
CTTATGTAGATAGACAGACAGCAATGTCAAGTCGTCTCACCTATGTCAATGGTGCCGGAAATGCTGTCGTGAAAG
TCGATAACACCTCATTTATCCAGAATGGTCCATTAGTTTATAGAAACTCGGTGCTTACCTGCCATCTTCATTTAG
CTTTAATTCTGTGCTAATTTGCTAATCTCTTAGGTACGCATCACATCGCAGGAAGTATACGGTATCGGGTCCTTA
ATTATAATCGACGTTCGACACATTCCATATGGGTGTTCTGTGTGTCAATCCCTTAACTTTTTCTCGAGTATATAC
TAATGACGTCCCAACAGGTGTGGCCCGCCTTCTGGACTCTTGGCTCTGGTAAAACTTGGCCGCAAGGGGGCGAAA
TCGACATCATTGAAAGTATCAACTTACTTCCCAACAACCAAATCGCGTTACACACCACGCCCGGCTGCTCTCAAT
CTCAGAATCTAGGACAGACAGGTCAAACTACCGAAGGAGATTGTTCTACTCCTCAGGGGTGCGTTGTACGAGAGA
CGAAAGCGAACAGCTACGAGTCCGGATTTGCTCAGGCTGGGGGAGGTGTATGGGCTACACAAATCGACGCCTCTG
GTATTTTTATTTGGTTTTGGAGTGTATGTCGCATTTATTTACTCCTCTTCTTCCTCCTTCTGATTTTCTGGAAAA
GAGACCTGATGTCCCGGAGAATATTAAAACATCTAATAATGCCTCATATATTGATACGGTGCCGTGGGGGATACC
TACTGCTTCATATCCAGCTGATGGTTGCAACATCTCGCAATATTTCACCCCTCAAAACCTCATATTACTTACCAC
GCTGTGTGGAAATTGGTAACAAAATTCGAAGCTCTACATCTTCGAAGATCTGATTTAAAATTTACAGGGCAGGTG
TCCCAGGCATCTACGACAGTACTTGCCATACGCCCACAATGTCTTGTGTGAGCTTTCTTTTCCTGCTTGAGTCAT
TTGAACGTTTAGCCTGATGTTGAGTACTAGGCTGTGGATAATGTAGTCGGTCCTGGAAGTCCGACGTATGATCAA
GCATACTGGGAGATTTCCTGGATACGAACTTATACCCTGGCTCTTCCTGGCCAACCTACCACTATTACATCGAGT
GATCCGCCTGTGCAGGACGCTTCGTCCATGACAGTATCACGAGGGGCGACCACTAGTACTATGCAAGCCACATCT
GCGGCTCTGACACCCGGACCCACAGTTTCTTCCGCCGTGTCCAGTACTTTGCCTACGACTTCGTGTGTGTTTGGG
AGTGTTCTACTTGTTGCGATGCTTGGTAACCTGATGCTACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail