Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|066500
Gene name
Locationscaffold_4:272094..274009
Strand+
Gene length (bp)1915
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 3.5E-10 74 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8GYB1|NUD15_ARATH Nudix hydrolase 15, mitochondrial OS=Arabidopsis thaliana GN=NUDT15 PE=1 SV=2 72 273 2.0E-26
sp|O22951|NUD22_ARATH Nudix hydrolase 22, chloroplastic OS=Arabidopsis thaliana GN=NUDT22 PE=2 SV=2 74 272 1.0E-23
sp|Q8LET2|NUD11_ARATH Nudix hydrolase 11 OS=Arabidopsis thaliana GN=NUDT11 PE=1 SV=2 73 272 6.0E-19
sp|Q12524|PCD1_YEAST Peroxisomal coenzyme A diphosphatase 1, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCD1 PE=1 SV=1 71 262 2.0E-16
sp|Q6D4L1|NUDL_PECAS Uncharacterized Nudix hydrolase NudL OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nudL PE=3 SV=1 70 195 6.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8GYB1|NUD15_ARATH Nudix hydrolase 15, mitochondrial OS=Arabidopsis thaliana GN=NUDT15 PE=1 SV=2 72 273 2.0E-26
sp|O22951|NUD22_ARATH Nudix hydrolase 22, chloroplastic OS=Arabidopsis thaliana GN=NUDT22 PE=2 SV=2 74 272 1.0E-23
sp|Q8LET2|NUD11_ARATH Nudix hydrolase 11 OS=Arabidopsis thaliana GN=NUDT11 PE=1 SV=2 73 272 6.0E-19
sp|Q12524|PCD1_YEAST Peroxisomal coenzyme A diphosphatase 1, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCD1 PE=1 SV=1 71 262 2.0E-16
sp|Q6D4L1|NUDL_PECAS Uncharacterized Nudix hydrolase NudL OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nudL PE=3 SV=1 70 195 6.0E-14
sp|Q7N3M0|NUDL_PHOLL Uncharacterized Nudix hydrolase NudL OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nudL PE=3 SV=1 72 257 8.0E-14
sp|P0C024|NUDT7_HUMAN Peroxisomal coenzyme A diphosphatase NUDT7 OS=Homo sapiens GN=NUDT7 PE=2 SV=1 57 269 5.0E-13
sp|Q9NA25|NDX8_CAEEL Peroxisomal coenzyme A diphosphatase ndx-8 OS=Caenorhabditis elegans GN=ndx-8 PE=1 SV=1 76 269 5.0E-12
sp|A7MKE8|NUDL_CROS8 Uncharacterized Nudix hydrolase NudL OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nudL PE=3 SV=1 64 243 4.0E-11
sp|Q99P30|NUDT7_MOUSE Peroxisomal coenzyme A diphosphatase NUDT7 OS=Mus musculus GN=Nudt7 PE=1 SV=2 73 269 5.0E-11
sp|B5XQ60|NUDL_KLEP3 Uncharacterized Nudix hydrolase NudL OS=Klebsiella pneumoniae (strain 342) GN=nudL PE=3 SV=1 72 192 8.0E-11
sp|B1JP41|NUDL_YERPY Uncharacterized Nudix hydrolase NudL OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nudL PE=3 SV=1 35 195 1.0E-10
sp|A7FJ95|NUDL_YERP3 Uncharacterized Nudix hydrolase NudL OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nudL PE=3 SV=1 35 195 1.0E-10
sp|Q1C8W1|NUDL_YERPA Uncharacterized Nudix hydrolase NudL OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nudL PE=3 SV=1 35 195 1.0E-10
sp|B2K0H0|NUDL_YERPB Uncharacterized Nudix hydrolase NudL OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nudL PE=3 SV=1 35 195 1.0E-10
sp|Q7CHW2|NUDL_YERPE Uncharacterized Nudix hydrolase NudL OS=Yersinia pestis GN=nudL PE=3 SV=1 35 195 1.0E-10
sp|A9R5X2|NUDL_YERPG Uncharacterized Nudix hydrolase NudL OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nudL PE=3 SV=1 35 195 1.0E-10
sp|Q1CH51|NUDL_YERPN Uncharacterized Nudix hydrolase NudL OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=nudL PE=3 SV=1 35 195 1.0E-10
sp|A4TKD0|NUDL_YERPP Uncharacterized Nudix hydrolase NudL OS=Yersinia pestis (strain Pestoides F) GN=nudL PE=3 SV=1 35 195 1.0E-10
sp|Q66BW8|NUDL_YERPS Uncharacterized Nudix hydrolase NudL OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nudL PE=3 SV=1 35 195 1.0E-10
sp|A1JMC0|NUDL_YERE8 Uncharacterized Nudix hydrolase NudL OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=nudL PE=3 SV=1 72 188 2.0E-10
sp|A6TAY4|NUDL_KLEP7 Uncharacterized Nudix hydrolase NudL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nudL PE=3 SV=1 72 243 4.0E-10
sp|A8AFP5|NUDL_CITK8 Uncharacterized Nudix hydrolase NudL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nudL PE=3 SV=1 64 243 6.0E-10
sp|P0A2K9|NUDL_SALTY Uncharacterized Nudix hydrolase NudL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nudL PE=3 SV=1 64 193 9.0E-10
sp|P0A2L0|NUDL_SALTI Uncharacterized Nudix hydrolase NudL OS=Salmonella typhi GN=nudL PE=3 SV=1 64 193 9.0E-10
sp|B4TXZ6|NUDL_SALSV Uncharacterized Nudix hydrolase NudL OS=Salmonella schwarzengrund (strain CVM19633) GN=nudL PE=3 SV=1 64 193 9.0E-10
sp|C0Q309|NUDL_SALPC Uncharacterized Nudix hydrolase NudL OS=Salmonella paratyphi C (strain RKS4594) GN=nudL PE=3 SV=1 64 193 9.0E-10
sp|A9MVU1|NUDL_SALPB Uncharacterized Nudix hydrolase NudL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nudL PE=3 SV=1 64 193 9.0E-10
sp|B5R2U5|NUDL_SALEP Uncharacterized Nudix hydrolase NudL OS=Salmonella enteritidis PT4 (strain P125109) GN=nudL PE=3 SV=1 64 193 9.0E-10
sp|Q57NI6|NUDL_SALCH Uncharacterized Nudix hydrolase NudL OS=Salmonella choleraesuis (strain SC-B67) GN=nudL PE=3 SV=1 64 193 9.0E-10
sp|B4SUL8|NUDL_SALNS Uncharacterized Nudix hydrolase NudL OS=Salmonella newport (strain SL254) GN=nudL PE=3 SV=1 64 193 9.0E-10
sp|B5BHD1|NUDL_SALPK Uncharacterized Nudix hydrolase NudL OS=Salmonella paratyphi A (strain AKU_12601) GN=nudL PE=3 SV=1 64 193 1.0E-09
sp|B5FTK8|NUDL_SALDC Uncharacterized Nudix hydrolase NudL OS=Salmonella dublin (strain CT_02021853) GN=nudL PE=3 SV=1 64 193 1.0E-09
sp|B5F3R6|NUDL_SALA4 Uncharacterized Nudix hydrolase NudL OS=Salmonella agona (strain SL483) GN=nudL PE=3 SV=1 64 193 1.0E-09
sp|B4TKF7|NUDL_SALHS Uncharacterized Nudix hydrolase NudL OS=Salmonella heidelberg (strain SL476) GN=nudL PE=3 SV=1 64 193 1.0E-09
sp|Q5PNL9|NUDL_SALPA Uncharacterized Nudix hydrolase NudL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nudL PE=3 SV=1 64 193 1.0E-09
sp|A4WBH1|NUDL_ENT38 Uncharacterized Nudix hydrolase NudL OS=Enterobacter sp. (strain 638) GN=nudL PE=3 SV=1 64 243 2.0E-09
sp|Q92350|YDH5_SCHPO Probable nudix hydrolase C6G9.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G9.05 PE=3 SV=1 73 193 6.0E-08
sp|Q23236|NDX3_CAEEL Nudix hydrolase 3 OS=Caenorhabditis elegans GN=ndx-3 PE=3 SV=2 64 235 8.0E-08
sp|P43338|NUDL_ENTAE Uncharacterized Nudix hydrolase NudL (Fragment) OS=Enterobacter aerogenes GN=nudL PE=3 SV=1 72 166 2.0E-07
sp|Q8WV74|NUDT8_HUMAN Nucleoside diphosphate-linked moiety X motif 8 OS=Homo sapiens GN=NUDT8 PE=1 SV=2 76 196 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|066500
MPSKDIPESQNRRRAHTKAGSPASSSVFTKSRNTRFLVESTNRITQLKPESKECIYRLASYTAPKLTVQVPKSRR
AAVLVALFIGRSGDLYVLLNRRSPTLRTYAGDTSLPGGKVELTDRNLEDTARREAFEEIGLPRDRRKVPLLCILE
PFLAAELVVTPVVVLILDNTLRPIINTDEVASLFSHPLASFLSTTSPFHATEPETIEVDYHTSFTVESSAPHGRK
YFYMVHQFLTGREAGGIKPIFGLTASMMVRVAVIGYGRFPDFQMTTPESAPLDEKIAWALLNRPVLRHACMKEGL
DMRLPLRICNVTRQEFEAMVKAQESTQESVWNAIQNTRCVSKLKETVKFR*
Coding >AgabiH97|066500
ATGCCCAGCAAGGACATACCGGAATCACAAAACCGACGGCGGGCTCATACTAAAGCTGGTTCTCCAGCGTCTTCG
TCTGTATTCACCAAATCGCGAAATACTCGATTTTTGGTTGAGTCCACTAACCGCATAACTCAGCTAAAACCCGAG
TCCAAAGAATGTATCTACCGACTCGCATCATATACCGCCCCCAAATTGACTGTTCAAGTCCCGAAATCGAGACGT
GCTGCTGTCTTGGTTGCGCTCTTTATCGGTAGGAGCGGTGATTTGTATGTACTACTCAATCGGAGATCTCCTACC
TTAAGGACTTATGCAGGCGATACATCATTACCAGGTGGGAAGGTAGAATTGACCGACAGGAATCTCGAAGATACT
GCGCGGAGAGAAGCTTTTGAGGAGATAGGGCTACCGCGGGATCGACGGAAGGTACCCCTTTTATGCATTCTGGAG
CCGTTTCTTGCAGCAGAATTGGTAGTAACACCAGTGGTGGTTCTAATTCTCGACAATACCCTACGACCCATCATC
AACACAGACGAAGTGGCCTCTCTTTTCTCTCATCCCCTCGCCTCATTTCTATCAACGACATCCCCCTTTCATGCA
ACCGAACCCGAAACAATCGAAGTAGACTACCATACATCATTTACCGTAGAATCGAGTGCACCGCATGGAAGAAAA
TATTTTTATATGGTTCATCAATTCCTGACTGGACGTGAAGCTGGCGGGATAAAACCGATATTTGGGCTCACTGCG
TCTATGATGGTTAGAGTGGCTGTAATAGGCTACGGCCGATTTCCCGACTTTCAAATGACGACCCCGGAATCAGCA
CCATTGGACGAAAAGATTGCATGGGCTTTACTCAACAGACCCGTCCTTCGGCACGCTTGTATGAAGGAAGGTCTG
GATATGAGATTACCCTTGAGAATATGTAATGTGACGCGACAAGAGTTCGAGGCGATGGTGAAAGCACAGGAGAGT
ACTCAAGAGTCGGTTTGGAATGCTATTCAGAATACTCGTTGTGTCTCAAAACTAAAGGAAACAGTCAAGTTCAGG
TGA
Transcript >AgabiH97|066500
ATGCCCAGCAAGGACATACCGGAATCACAAAACCGACGGCGGGCTCATACTAAAGCTGGTTCTCCAGCGTCTTCG
TCTGTATTCACCAAATCGCGAAATACTCGATTTTTGGTTGAGTCCACTAACCGCATAACTCAGCTAAAACCCGAG
TCCAAAGAATGTATCTACCGACTCGCATCATATACCGCCCCCAAATTGACTGTTCAAGTCCCGAAATCGAGACGT
GCTGCTGTCTTGGTTGCGCTCTTTATCGGTAGGAGCGGTGATTTGTATGTACTACTCAATCGGAGATCTCCTACC
TTAAGGACTTATGCAGGCGATACATCATTACCAGGTGGGAAGGTAGAATTGACCGACAGGAATCTCGAAGATACT
GCGCGGAGAGAAGCTTTTGAGGAGATAGGGCTACCGCGGGATCGACGGAAGGTACCCCTTTTATGCATTCTGGAG
CCGTTTCTTGCAGCAGAATTGGTAGTAACACCAGTGGTGGTTCTAATTCTCGACAATACCCTACGACCCATCATC
AACACAGACGAAGTGGCCTCTCTTTTCTCTCATCCCCTCGCCTCATTTCTATCAACGACATCCCCCTTTCATGCA
ACCGAACCCGAAACAATCGAAGTAGACTACCATACATCATTTACCGTAGAATCGAGTGCACCGCATGGAAGAAAA
TATTTTTATATGGTTCATCAATTCCTGACTGGACGTGAAGCTGGCGGGATAAAACCGATATTTGGGCTCACTGCG
TCTATGATGGTTAGAGTGGCTGTAATAGGCTACGGCCGATTTCCCGACTTTCAAATGACGACCCCGGAATCAGCA
CCATTGGACGAAAAGATTGCATGGGCTTTACTCAACAGACCCGTCCTTCGGCACGCTTGTATGAAGGAAGGTCTG
GATATGAGATTACCCTTGAGAATATGTAATGTGACGCGACAAGAGTTCGAGGCGATGGTGAAAGCACAGGAGAGT
ACTCAAGAGTCGGTTTGGAATGCTATTCAGAATACTCGTTGTGTCTCAAAACTAAAGGAAACAGTCAAGTTCAGG
TGA
Gene >AgabiH97|066500
ATGCCCAGCAAGGACATACCGGAATCACAAAACCGACGGCGGGCTCATACTAAAGCTGGTTCTCCAGCGTCTTCG
TCTGTATTCACCAAATCGCGAAATACTCGATTTTTGGTTGAGTCCACTAACCGCATAACTCAGCTAAAACCCGAG
TCCAAAGAGTACGTCCTGCGCATCGTCATTTCCTCTTTTATTCTATCCAGCCAGCTGAGGAAAACACGAACAATA
GATGTATCTACCGACTCGCATCATATACCGCCCCCAAATTGACTGTTCAAGTCCCGAAATCGAGACGTGCTGCTG
TCTTGGTTGCGCTCTTTATCGGTAGGAGCGGTGATTTGTATGTACTACTCAATCGGTGCGTCTATGGTCTCTGAA
ACCTTTTCCTCTTGTTAAACAGCTCATCGAACGTTGGTCGTGTCATATAGGAGATCTCCTACCTTAAGGACTTAT
GCAGGCGATACATCATTACCAGGTGGGAAGGTAGAATTGACCGACAGGAATCTCGAAGATACTGCGGTACGTTCA
GTCTTCATTTAGGTCTACTTTCTTTACTTAGTTGTTGATTTCAGCGGAGAGAAGCTTTTGAGGAGGTGAGCAAGA
GGTTTCTCTTTGGTTGCTGAGACAGCCGTTAACGTATTTGCATCAAGATAGGGCTACCGCGGGATCGACGGAAGG
TACCCCTTTTATGCATTCTGGAGCCGTTTCTTGCAGCAGAATTGGTAGTAACACCGTATGTGTTCATTTGAACGT
GTCCTGTTAAAACTCATTCATCTGCTCCTAGAGTGGTGGTTCTAATTCTCGACAATACCCTACGAGTAAGTTGCC
GTTCAATACACCATCGTCTAGCCCTCTTCTAACCCATCACTCATTGCCATTTGCATAGCCCATCATCAACACAGA
CGAAGTGGCCTCTCTTTTCTCTCATCCCCTCGCCTCATTTCTATCAACGACATCCCCCTTTCATGCAACCGAACC
CGAAACAATCGAAGTAGACTACCATACATCATTTACCGTAGAATCGAGTGCACCGCATGGAAGAAAATATTTTTA
TATGGTTCATCAATTCCTGACTGGACGTGAAGCTGGCGGGATAAAACCGATATTTGGGCTCACTGCGTAAGTTTC
CTCATATACACACTTTCTTTGGTTGACACCGGAAAATTTCTAACTTTCATTTAGGTCTATGATGGTTAGAGTGGC
TGTAATAGGCTACGGCCGATTTCCCGACTTTCAAATGACGACCCCGGAATCAGCACCATTGGACGAAAAGATTGC
ATGGGCTTTACTCAACAGACCCGTCCTTCGGCACGCTTGTATGAAGGAAGGTCTGGATATGAGATTACCCTTGAG
AATATGTAATGTGACGCGACAAGAGTTCGAGGCGATGGTGAAAGCACAGGAGAGTACTCAAGAGGTGAAAGATGG
GAAGAAACGGCATTCGATGCACTCGTCTGGAAGAAACTGGATGAGAGCATGGAAGACGAAACTCTAATGTATGTT
ACTTGGATACGTGATATTTCTAATTCTACTTAGCCGTTTGACCGAGTGTCAATCGGTAGCCAATGTTATAAAGAA
CACTTCTCGGAGAAAGCACCATTTTTCTTACTTAACCGTTCTGATCCAACAAATCCTTACCTCGGGGTCTTCCTT
TCGAAGCTCGTGTTTATCGAAGCGCAGGAGAGTACTCGAGTTTAAAGGTGGGATGAAGCTGGATGAGAGCACGGA
GGCTGAAAATTTAGCGTGTATCTGATATTCCTCTTGGAGTCTTTCGGTACTTAGTCGTTTGACTGGGTGTCAGTC
GGTTTGGAATGCTATTCAGAATACTCGTTGTGTCTCAAAACGTAAGAATTCGATTAGCCATAGAAAACGTGCATA
TCATGATACAAAAGTAAAGGAAACAGTCAAGTTCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail