Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|066480
Gene name
Locationscaffold_4:267333..268946
Strand-
Gene length (bp)1613
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.0E-13 87 190
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 4.2E-15 87 329
PF12146 Hydrolase_4 Serine aminopeptidase, S33 9.5E-15 85 325

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P9WNH3|Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2715 PE=1 SV=1 83 194 6.0E-13
sp|P9WNH2|Y2715_MYCTO Uncharacterized protein MT2788 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2788 PE=3 SV=1 83 194 6.0E-13
sp|P0A573|Y2734_MYCBO Uncharacterized protein Mb2734 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2734 PE=3 SV=1 83 194 6.0E-13
sp|P29715|BPOA2_STRAU Non-haem bromoperoxidase BPO-A2 OS=Streptomyces aureofaciens GN=bpoA2 PE=1 SV=3 84 185 1.0E-09
sp|O31168|PRXC_STRAU Non-heme chloroperoxidase OS=Streptomyces aureofaciens GN=cpo PE=1 SV=1 84 185 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P9WNH3|Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2715 PE=1 SV=1 83 194 6.0E-13
sp|P9WNH2|Y2715_MYCTO Uncharacterized protein MT2788 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2788 PE=3 SV=1 83 194 6.0E-13
sp|P0A573|Y2734_MYCBO Uncharacterized protein Mb2734 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2734 PE=3 SV=1 83 194 6.0E-13
sp|P29715|BPOA2_STRAU Non-haem bromoperoxidase BPO-A2 OS=Streptomyces aureofaciens GN=bpoA2 PE=1 SV=3 84 185 1.0E-09
sp|O31168|PRXC_STRAU Non-heme chloroperoxidase OS=Streptomyces aureofaciens GN=cpo PE=1 SV=1 84 185 1.0E-09
sp|P23133|TODF_PSEP1 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todF PE=3 SV=2 84 304 1.0E-09
sp|P22862|ESTE_PSEFL Arylesterase OS=Pseudomonas fluorescens PE=1 SV=4 83 171 2.0E-09
sp|A2BGU9|SERHL_DANRE Serine hydrolase-like protein OS=Danio rerio GN=serhl PE=2 SV=1 70 332 1.0E-08
sp|O52866|HYES_CORS2 Soluble epoxide hydrolase OS=Corynebacterium sp. (strain C12) PE=1 SV=3 73 250 3.0E-08
sp|P47229|BPHD_BURXL 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Burkholderia xenovorans (strain LB400) GN=bphD PE=1 SV=1 83 288 3.0E-08
sp|Q9AQM4|CARC_PSERE 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase OS=Pseudomonas resinovorans GN=carC PE=1 SV=1 51 306 3.0E-08
sp|Q52036|BPHD_PSEPU 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Pseudomonas putida GN=bphD PE=3 SV=1 83 288 4.0E-08
sp|Q55921|PRXC_SYNY3 Putative non-heme chloroperoxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0314 PE=3 SV=1 84 184 4.0E-08
sp|P49323|PRXC_STRLI Non-heme chloroperoxidase OS=Streptomyces lividans GN=cpo PE=1 SV=2 80 185 9.0E-08
sp|P19076|DMPD_PSEUF 2-hydroxymuconate semialdehyde hydrolase OS=Pseudomonas sp. (strain CF600) GN=dmpD PE=3 SV=1 84 292 9.0E-08
sp|A1VUV0|BPHD_POLNA 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Polaromonas naphthalenivorans (strain CJ2) GN=bphD PE=3 SV=1 83 288 2.0E-07
sp|Q2VLB9|BPHD_BURCE 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Burkholderia cepacia GN=bphD PE=3 SV=1 84 188 3.0E-07
sp|Q54M29|Y6239_DICDI Serine hydrolase-like protein DDB_G0286239 OS=Dictyostelium discoideum GN=DDB_G0286239 PE=3 SV=2 80 189 4.0E-07
sp|Q52011|BPHD_PSEPS 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Pseudomonas pseudoalcaligenes GN=bphD PE=2 SV=1 83 288 5.0E-07
sp|Q49KF8|MHPC1_PSEPU 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 1 OS=Pseudomonas putida GN=mhpC1 PE=3 SV=2 82 267 7.0E-07
sp|O31158|PRXC_PSEFL Non-heme chloroperoxidase OS=Pseudomonas fluorescens GN=cpo PE=1 SV=3 83 189 1.0E-06
sp|B0SY51|DHMA_CAUSK Haloalkane dehalogenase OS=Caulobacter sp. (strain K31) GN=dhmA PE=3 SV=1 73 212 4.0E-06
sp|P9WNH5|HSAD_MYCTU 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hsaD PE=1 SV=1 73 222 5.0E-06
sp|P9WNH4|HSAD_MYCTO 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hsaD PE=3 SV=1 73 222 5.0E-06
sp|A6TAC7|MHPC_KLEP7 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mhpC PE=3 SV=1 83 187 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 331 353 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|066480
MVSSPYYHCLTLSLLLVPPLIFGTYLLVAFPSPPETLSLHPSLASLPRHAKSWQIYPEDFYEGGSYVSFPQGRMR
YWLLGPENGKKVVLIHGLSIPAIVWKDIAPRLVARGYRVLLYDLYGRGYSDAPETTYEPGLFTIQLALLMQHLNW
DKASIVGSSMGGGIAAAFTAHFPHLVDEKVILIASAGLIENCDISRTAKFMSSPLVQSVASSMPFRKYLQRLTNT
TSITGDDEVDPMIEIVRVQSAHLPGYNAALSSSLRDGPIRGQSAMFASSGFEGKKVLLIHGTKDVTVHPKYAPRI
IELLPDETKKSAKLVTIEDGGHEIVLTHAEIVWWMTVCDLVWIHSILCFFVYGSWDSLF*
Coding >AgabiH97|066480
ATGGTTTCCAGTCCATATTATCACTGCCTGACCTTGTCTCTCCTTCTTGTACCCCCTCTCATTTTTGGCACTTAC
TTGCTCGTGGCTTTTCCCAGCCCTCCAGAAACACTCAGCCTCCACCCTTCCCTTGCCAGTCTCCCCAGGCATGCC
AAATCATGGCAAATATATCCAGAGGACTTCTACGAAGGAGGCTCATATGTGTCTTTCCCCCAGGGTCGCATGAGG
TACTGGCTCTTGGGCCCGGAGAATGGGAAGAAAGTCGTCTTGATCCATGGTTTATCGATACCCGCCATCGTTTGG
AAAGATATTGCCCCGCGCCTCGTTGCACGTGGTTACCGTGTTCTACTTTACGATCTCTACGGAAGAGGTTACTCG
GATGCGCCAGAGACCACATATGAACCTGGGCTCTTTACTATTCAGCTTGCACTCCTCATGCAACATCTCAACTGG
GATAAAGCCAGCATCGTGGGCTCGTCTATGGGCGGTGGTATAGCAGCTGCATTTACTGCGCATTTTCCCCACTTA
GTTGATGAGAAGGTTATACTAATCGCTTCTGCGGGGCTAATTGAGAATTGTGACATATCTCGCACGGCCAAGTTC
ATGTCCTCGCCTTTAGTTCAATCGGTTGCCTCGAGCATGCCATTCCGAAAATATTTGCAACGTCTGACAAATACA
ACATCGATTACCGGCGACGACGAAGTTGATCCTATGATCGAGATCGTCCGGGTTCAATCAGCCCACTTGCCGGGA
TACAATGCCGCTTTATCATCCTCCTTGAGGGACGGGCCAATAAGAGGACAATCAGCAATGTTTGCGTCGAGTGGA
TTCGAAGGAAAGAAGGTTTTATTAATTCACGGAACAAAAGATGTGACGGTGCATCCAAAATACGCTCCTCGTATC
ATTGAGCTTTTACCAGATGAAACCAAAAAGTCAGCGAAACTTGTCACGATAGAGGACGGGGGTCACGAAATAGTG
CTGACACACGCGGAAATTGTGTGGTGGATGACTGTATGTGATTTGGTTTGGATCCATTCCATACTGTGCTTTTTT
GTTTACGGAAGTTGGGACTCTTTATTTTAA
Transcript >AgabiH97|066480
ATGGTTTCCAGTCCATATTATCACTGCCTGACCTTGTCTCTCCTTCTTGTACCCCCTCTCATTTTTGGCACTTAC
TTGCTCGTGGCTTTTCCCAGCCCTCCAGAAACACTCAGCCTCCACCCTTCCCTTGCCAGTCTCCCCAGGCATGCC
AAATCATGGCAAATATATCCAGAGGACTTCTACGAAGGAGGCTCATATGTGTCTTTCCCCCAGGGTCGCATGAGG
TACTGGCTCTTGGGCCCGGAGAATGGGAAGAAAGTCGTCTTGATCCATGGTTTATCGATACCCGCCATCGTTTGG
AAAGATATTGCCCCGCGCCTCGTTGCACGTGGTTACCGTGTTCTACTTTACGATCTCTACGGAAGAGGTTACTCG
GATGCGCCAGAGACCACATATGAACCTGGGCTCTTTACTATTCAGCTTGCACTCCTCATGCAACATCTCAACTGG
GATAAAGCCAGCATCGTGGGCTCGTCTATGGGCGGTGGTATAGCAGCTGCATTTACTGCGCATTTTCCCCACTTA
GTTGATGAGAAGGTTATACTAATCGCTTCTGCGGGGCTAATTGAGAATTGTGACATATCTCGCACGGCCAAGTTC
ATGTCCTCGCCTTTAGTTCAATCGGTTGCCTCGAGCATGCCATTCCGAAAATATTTGCAACGTCTGACAAATACA
ACATCGATTACCGGCGACGACGAAGTTGATCCTATGATCGAGATCGTCCGGGTTCAATCAGCCCACTTGCCGGGA
TACAATGCCGCTTTATCATCCTCCTTGAGGGACGGGCCAATAAGAGGACAATCAGCAATGTTTGCGTCGAGTGGA
TTCGAAGGAAAGAAGGTTTTATTAATTCACGGAACAAAAGATGTGACGGTGCATCCAAAATACGCTCCTCGTATC
ATTGAGCTTTTACCAGATGAAACCAAAAAGTCAGCGAAACTTGTCACGATAGAGGACGGGGGTCACGAAATAGTG
CTGACACACGCGGAAATTGTGTGGTGGATGACTGTATGTGATTTGGTTTGGATCCATTCCATACTGTGCTTTTTT
GTTTACGGAAGTTGGGACTCTTTATTTTAA
Gene >AgabiH97|066480
ATGGTTTCCAGTCCATATTATCACTGCCTGACCTTGTCTCTCCTTCTTGTACCCCCTCTCATTTTTGGCACTTAC
TTGCTCGTGGCTTTTCCCAGCCCTCCAGAAACACTCAGCCTCCACCCTTCCCTTGCCAGTCTCCCCAGGCATGCC
AAATCATGGCAAATATATCCAGAGGACTTCTACGAAGGAGGCTCATATGTGTCTTTCCCCCAGGGTCGCATGAGG
TACTGGCTCTTGGGCCCGGAGAATGGGAAGAAAGTACGTCTTCATATAACCAATTAGGGGCAAAGAGTTAACCTT
TGCCTTTGCGCACGTTGCAGGTCGTCTTGATCCATGGTTTATCGATACCCGCCATCGTTTGGAAAGATATTGCCC
CGCGCCTCGTTGCACGTGGTTACCGTGTTCTACTTTACGGTTGGTTCTGTCGTGCTGGCATGCTACACGTCAGTT
TAATCAGGCACTATAGATCTCTACGGAAGAGGTTACTCGGATGCGCCAGAGACCACATATGAACCTGGGCTCTTT
ACTATTCAGCTTGCACTCCTCATGCAACATCTCAACTGGGATAAAGCCAGCATCGTGGGCTCGTCTATGGTACGT
ATAACGGGTGCCGACCGGTTTGATCCTACTTACATTCAGCGCTTGTGTGTTTCAACTGCGTGTCATTCTTCAGGG
CGGTGGTATAGCAGCTGCATTTACTGCGCATTTTCCCCACTTAGTTGATGAGAAGGTTATACTAATCGCTTCTGC
GGGGCTAATTGAGGTCGGTATTCTTCTTTGGTGAACTCCTATTTGGTTACTTTAACATGGTCTGCTTATCTAGAA
TTGTGACATATCTCGCACGGCCAAGTTCATGTCCTCGCCTTTAGTTCAATCGGTTGCCTCGAGCATGCCATTCCG
AGTATGTGTATTCTGTGATGTCCAATTCTTCACACTCACTTCAGCATTCAGAAATATTTGCAACGTCTGACAAAT
ACAACATCGATTACCGGCGACGACGAAGTTGATCCTATGATCGAGGTGATTACCAAAGTCTCTCACCATTCTACG
AACGCTATTTTTTAACGTCTCGTAATAGATCGTCCGGGTTCAATCAGCCCACTTGCCGGGATACAATGCCGCTTT
ATCATCCTCCTTGAGGGACGGGCCAATAAGAGGACAATCAGCAATGTTTGCGTCGAGTGGATTCGAAGGAAAGAA
GGTTTTATTAATTCACGTAAGTCATATATCACCGTATCGAGCTCTCTACTAAGGCAATTCGACCTAGGGAACAAA
AGATGTGACGGTGCATCCAAAATACGCTCCTCGTATCATTGAGCTTTTACCAGATGAAACCAAAAAGTCAGCGAA
ACTTGTCACGATAGAGGACGGGGGTCACGAAATAGTGCTGACACACGCGGAAATTGTAACCGACGAGATGATCCA
GTTTTTGGAAGCAAAACACTGAGATGACATGCTAGGTGTGGTGGATGACTGGTGAGTGACTACTAATGACAGTAG
ATTCTTGACTGTTGACGGTGCGGTTGCTTTTTCGGGCACAAGTATGTGATTTGGTTTGGATCCATTCCATACTGT
GCTTTTTTGTTTACGGAAGTTGGGACTCTTTATTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail