Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|066280
Gene name
Locationscaffold_4:218383..219376
Strand+
Gene length (bp)993
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 2.3E-10 135 277

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5UR03|YL905_MIMIV Uncharacterized protein L905 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L905 PE=3 SV=1 135 277 8.0E-14
sp|Q80Y20|ALKB8_MOUSE Alkylated DNA repair protein alkB homolog 8 OS=Mus musculus GN=Alkbh8 PE=1 SV=1 125 277 2.0E-11
sp|Q96BT7|ALKB8_HUMAN Alkylated DNA repair protein alkB homolog 8 OS=Homo sapiens GN=ALKBH8 PE=1 SV=2 125 277 1.0E-10
sp|Q95K79|ALKB8_MACFA Alkylated DNA repair protein alkB homolog 8 OS=Macaca fascicularis GN=ALKBH8 PE=2 SV=1 125 277 9.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|066280
MDTSTSTDNNKRKLTEDDHQICHPRKHLRIEIPSTIFPSTISDTLSSTTTSPSSLFSAISPPQQDLDHPSSATTC
TLQTPALLIAPPISGLYFNPGLEIPADLADSVFTFFNNITPTYPKPPTRHIIHSPTPAYSFILNLYTPGEGIASH
VDLLKRFGDGIIGVSLGSGCVMRFTRTLADSTPGEGPARLSIHDEPVNLSDPLSCPESDVDEGVAYDVYLPERSV
LVLSSDARYKWTHGIEKRKSDFISCPDCVPDIPSAIKGRWVERGTRLSITYRWLLPGADVVGCDE*
Coding >AgabiH97|066280
ATGGATACATCCACAAGCACCGATAATAACAAGAGAAAGTTAACTGAAGACGATCACCAAATATGCCATCCGAGA
AAGCACCTTCGCATAGAAATACCATCCACCATATTCCCGTCTACAATATCTGATACTCTGTCTTCTACTACCACT
TCTCCTTCATCTCTATTCTCTGCTATATCTCCTCCTCAACAAGATCTGGATCATCCTTCGTCCGCGACTACTTGT
ACTCTACAAACACCTGCTCTACTTATTGCCCCTCCAATATCGGGTCTGTATTTCAACCCAGGCCTAGAAATCCCG
GCAGACCTCGCAGATTCGGTTTTTACTTTCTTCAACAACATCACTCCCACCTATCCTAAACCGCCTACTCGACAC
ATTATTCACTCTCCTACGCCCGCATATTCCTTCATTCTGAATTTATACACTCCCGGAGAGGGTATAGCTTCGCAT
GTGGATTTATTAAAAAGGTTCGGAGACGGGATTATCGGGGTCAGCCTTGGAAGTGGCTGTGTTATGCGCTTCACC
AGGACACTGGCAGACTCTACCCCAGGTGAAGGGCCAGCAAGGCTTTCCATCCACGACGAACCAGTCAACCTCTCA
GATCCCTTATCTTGTCCGGAGAGCGACGTAGATGAGGGGGTTGCTTATGATGTTTACCTTCCTGAGCGAAGTGTT
CTCGTTCTCTCTTCTGATGCCCGCTACAAGTGGACACATGGAATCGAGAAACGAAAATCAGATTTTATCTCTTGT
CCTGACTGCGTTCCCGACATACCTTCCGCTATAAAAGGCCGCTGGGTTGAGCGGGGAACTCGGCTGAGCATCACG
TATCGCTGGTTACTTCCTGGGGCCGACGTAGTTGGTTGTGATGAATGA
Transcript >AgabiH97|066280
ATGGATACATCCACAAGCACCGATAATAACAAGAGAAAGTTAACTGAAGACGATCACCAAATATGCCATCCGAGA
AAGCACCTTCGCATAGAAATACCATCCACCATATTCCCGTCTACAATATCTGATACTCTGTCTTCTACTACCACT
TCTCCTTCATCTCTATTCTCTGCTATATCTCCTCCTCAACAAGATCTGGATCATCCTTCGTCCGCGACTACTTGT
ACTCTACAAACACCTGCTCTACTTATTGCCCCTCCAATATCGGGTCTGTATTTCAACCCAGGCCTAGAAATCCCG
GCAGACCTCGCAGATTCGGTTTTTACTTTCTTCAACAACATCACTCCCACCTATCCTAAACCGCCTACTCGACAC
ATTATTCACTCTCCTACGCCCGCATATTCCTTCATTCTGAATTTATACACTCCCGGAGAGGGTATAGCTTCGCAT
GTGGATTTATTAAAAAGGTTCGGAGACGGGATTATCGGGGTCAGCCTTGGAAGTGGCTGTGTTATGCGCTTCACC
AGGACACTGGCAGACTCTACCCCAGGTGAAGGGCCAGCAAGGCTTTCCATCCACGACGAACCAGTCAACCTCTCA
GATCCCTTATCTTGTCCGGAGAGCGACGTAGATGAGGGGGTTGCTTATGATGTTTACCTTCCTGAGCGAAGTGTT
CTCGTTCTCTCTTCTGATGCCCGCTACAAGTGGACACATGGAATCGAGAAACGAAAATCAGATTTTATCTCTTGT
CCTGACTGCGTTCCCGACATACCTTCCGCTATAAAAGGCCGCTGGGTTGAGCGGGGAACTCGGCTGAGCATCACG
TATCGCTGGTTACTTCCTGGGGCCGACGTAGTTGGTTGTGATGAATGA
Gene >AgabiH97|066280
ATGGATACATCCACAAGCACCGATAATAACAAGAGAAAGTTAACTGAAGACGATCACCAAATATGCCATCCGAGA
AAGCACCTTCGCATAGAAATACCATCCACCATATTCCCGTCTACAATATCTGATACTCTGTCTTCTACTACCACT
TCTCCTTCATCTCTATTCTCTGCTATATCTCCTCCTCAACAAGATCTGGATCATCCTTCGTCCGCGACTACTTGT
ACTCTACAAACACCTGCTCTACTTATTGCCCCTCCAATATCGGGTCTGTATTTCAACCCAGGCCTAGAAATCCCG
GCAGACCTCGCAGATTCGGTTTTTACTTTCTGTATGTCGACATACTTTTGCAACCCGAAAATCAACCAAATTATG
CTTTTTACACGACTCTCTTCTCAGTCAACAACATCACTCCCACCTATCCTAAACCGCCTACTCGACACATTATTC
ACTCTCCTACGCCCGCATATTCCTGTAGAAACCCATAACCTGCTTTTTCCCGCCGCCTCTACTCAAGCACGACAA
GTCATTCTGAATTTATACACTCCCGGAGAGGGTATAGCTTCGCATGTGGATTTATTAAAAAGGTTCGGAGACGGG
ATTATCGGGGTCAGCCTTGGAAGTGGCTGTGTTATGCGCTTCACCAGGACACTGGCAGACTCTACCCCAGGTGAA
GGGCCAGCAAGGCTTTCCATCCACGACGAACCAGTCAACCTCTCAGATCCCTTATCTTGTCCGGAGAGCGACGTA
GATGAGGGGGTTGCTTATGATGTTTACCTTCCTGAGCGAAGTGTTCTCGTTCTCTCTTCTGATGCCCGCTACAAG
TGGACACATGGAATCGAGAAACGAAAATCAGATTTTATCTCTTGTCCTGACTGCGTTCCCGACATACCTTCCGCT
ATAAAAGGCCGCTGGGTTGAGCGGGGAACTCGGCTGAGCATCACGTATCGCTGGTTACTTCCTGGGGCCGACGTA
GTTGGTTGTGATGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail