Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|066130
Gene name
Locationscaffold_4:184329..185738
Strand+
Gene length (bp)1409
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02102 Peptidase_M35 Deuterolysin metalloprotease (M35) family 1.5E-34 10 335
PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase 1.6E-22 204 334
PF13933 HRXXH Putative peptidase family 4.2E-10 156 339

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5FR79|NPIIA_ARTOC Probable neutral protease 2 homolog MCYG_05201 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_05201 PE=3 SV=1 49 336 1.0E-30
sp|E4UR63|NPIIC_ARTGP Neutral protease 2 homolog MGYG_02351 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02351 PE=3 SV=1 25 338 9.0E-28
sp|C5NZL6|MEP8_COCP7 Neutral protease 2 homolog MEP8 OS=Coccidioides posadasii (strain C735) GN=MEP8 PE=3 SV=1 36 334 3.0E-26
sp|C5P3T4|MEP7_COCP7 Neutral protease 2 homolog MEP7 OS=Coccidioides posadasii (strain C735) GN=MEP7 PE=3 SV=1 37 339 4.0E-26
sp|Q09016|MEP20_ASPFM Neutral protease 2 homolog mep20 OS=Neosartorya fumigata GN=mep20 PE=3 SV=1 9 334 4.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5FR79|NPIIA_ARTOC Probable neutral protease 2 homolog MCYG_05201 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_05201 PE=3 SV=1 49 336 1.0E-30
sp|E4UR63|NPIIC_ARTGP Neutral protease 2 homolog MGYG_02351 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02351 PE=3 SV=1 25 338 9.0E-28
sp|C5NZL6|MEP8_COCP7 Neutral protease 2 homolog MEP8 OS=Coccidioides posadasii (strain C735) GN=MEP8 PE=3 SV=1 36 334 3.0E-26
sp|C5P3T4|MEP7_COCP7 Neutral protease 2 homolog MEP7 OS=Coccidioides posadasii (strain C735) GN=MEP7 PE=3 SV=1 37 339 4.0E-26
sp|Q09016|MEP20_ASPFM Neutral protease 2 homolog mep20 OS=Neosartorya fumigata GN=mep20 PE=3 SV=1 9 334 4.0E-26
sp|D4DGR5|NPIIC_TRIVH Probable neutral protease 2 homolog TRV_06370 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06370 PE=3 SV=1 47 334 6.0E-26
sp|D4AM79|NPIIC_ARTBC Probable neutral protease 2 homolog ARB_04769 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04769 PE=3 SV=1 47 334 6.0E-26
sp|C4JH04|NPIIC_UNCRE Neutral protease 2 homolog UREG_01255 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01255 PE=3 SV=1 44 337 8.0E-26
sp|C0IPP1|NPIIA_TRIRU Probable neutral protease 2 homolog A OS=Trichophyton rubrum GN=NpII-A PE=3 SV=1 47 338 3.0E-25
sp|D4B639|NPIID_ARTBC Probable neutral protease 2 homolog ARB_03949 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03949 PE=3 SV=1 47 338 4.0E-25
sp|D4D616|NPIID_TRIVH Probable neutral protease 2 homolog TRV_02539 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02539 PE=3 SV=1 47 338 7.0E-25
sp|B0Y4X9|NPIIB_ASPFC Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_070680 PE=3 SV=1 9 334 8.0E-25
sp|Q2UP30|NPIIA_ASPOR Neutral protease 2 homolog AO090001000135 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090001000135 PE=3 SV=1 44 340 9.0E-25
sp|Q4WQR6|NPIIA_ASPFU Neutral protease 2 homolog AFUA_4G13750 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G13750 PE=3 SV=1 9 334 1.0E-24
sp|C0IPP2|NPIIB_TRIRU Probable neutral protease 2 homolog B OS=Trichophyton rubrum GN=NpII-B PE=3 SV=1 47 338 2.0E-24
sp|C5FCA7|NPIIB_ARTOC Probable neutral protease 2 homolog MCYG_00239 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_00239 PE=3 SV=1 47 338 2.0E-24
sp|P47189|PLNC_PENCI Penicillolysin OS=Penicillium citrinum GN=plnC PE=1 SV=1 36 337 2.0E-24
sp|Q4WA45|NPIIC_ASPFU Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G02700 PE=3 SV=3 36 342 3.0E-24
sp|E4US45|NPIID_ARTGP Neutral protease 2 homolog MGYG_03465 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03465 PE=3 SV=1 47 340 4.0E-24
sp|P46076|NPII_ASPOR Neutral protease 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090010000493 PE=1 SV=2 33 337 8.0E-24
sp|A1CVX6|NPIIB_NEOFI Neutral protease 2 homolog NFIA_102630 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_102630 PE=3 SV=1 9 334 8.0E-24
sp|Q9Y7F7|PLMP_ARMME Peptidyl-Lys metalloendopeptidase OS=Armillaria mellea GN=MEP PE=1 SV=1 6 334 2.0E-23
sp|D4ANL2|NPIIB_ARTBC Probable neutral protease 2 homolog ARB_05817 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05817 PE=3 SV=1 47 334 2.0E-23
sp|B8NJB2|NPIIA_ASPFN Neutral protease 2 homolog AFLA_065450 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_065450 PE=3 SV=1 19 338 2.0E-23
sp|A1DA48|NPIIA_NEOFI Neutral protease 2 homolog NFIA_031120 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_031120 PE=3 SV=1 36 342 3.0E-23
sp|D4DE03|NPIIB_TRIVH Probable neutral protease 2 homolog TRV_05367 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05367 PE=3 SV=1 47 334 4.0E-23
sp|B0YEV0|NPIIA_ASPFC Neutral protease 2 homolog AFUB_100460 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_100460 PE=3 SV=2 36 334 5.0E-23
sp|Q5AUR8|NPIIA_EMENI Neutral protease 2 homolog AN7962 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7962 PE=3 SV=1 5 338 6.0E-23
sp|A7F811|NPIIA_SCLS1 Neutral protease 2 homolog SS1G_13741 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_13741 PE=3 SV=1 47 338 1.0E-22
sp|C5PE18|MEP6_COCP7 Neutral protease 2 homolog MEP6 OS=Coccidioides posadasii (strain C735) GN=MEP6 PE=3 SV=1 6 340 2.0E-22
sp|A1CIU4|NPIIA_ASPCL Neutral protease 2 homolog ACLA_052720 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_052720 PE=3 SV=1 9 340 3.0E-22
sp|Q0V1D7|NPIIB_PHANO Neutral protease 2 homolog SNOG_02177 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02177 PE=3 SV=1 36 343 3.0E-22
sp|C4JLQ3|NPIIA_UNCRE Neutral protease 2 homolog UREG_03761 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_03761 PE=3 SV=1 6 334 4.0E-22
sp|E4UUX3|NPIIA_ARTGP Neutral protease 2 homolog MGYG_04094 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_04094 PE=3 SV=1 47 338 6.0E-22
sp|C5FPC2|NPIIC_ARTOC Probable neutral protease 2 homolog MCYG_04257 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04257 PE=3 SV=1 47 338 7.0E-22
sp|Q5B7T7|NPIIB_EMENI Neutral protease 2 homolog AN3393 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3393 PE=3 SV=1 25 337 1.0E-21
sp|A6SBW7|NPIIA_BOTFB Neutral protease 2 homolog SNOG_10522 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_10098 PE=3 SV=1 47 338 1.0E-21
sp|C5P507|MEP3_COCP7 Neutral protease 2 homolog MEP3 OS=Coccidioides posadasii (strain C735) GN=MEP3 PE=3 SV=1 6 337 2.0E-21
sp|E5R1Z3|NPIIB_ARTGP Neutral protease 2 homolog MGYG_00813 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00813 PE=3 SV=1 47 334 2.0E-21
sp|C5JHY1|NPIIB_AJEDS Neutral protease 2 homolog BDBG_02110 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_02110 PE=3 SV=1 21 340 3.0E-21
sp|Q0CMZ3|NPIIA_ASPTN Neutral protease 2 homolog ATEG_04941 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_04941 PE=3 SV=1 16 340 3.0E-21
sp|P81054|PLMP_GRIFR Peptidyl-Lys metalloendopeptidase OS=Grifola frondosa GN=MEP PE=1 SV=2 1 334 7.0E-21
sp|D4AJ87|NPIIF_ARTBC Neutral protease 2 homolog ARB_04336 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04336 PE=3 SV=1 47 334 2.0E-20
sp|C4JK49|NPIIB_UNCRE Neutral protease 2 homolog UREG_02006 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_02006 PE=3 SV=1 37 337 2.0E-20
sp|C5FIT1|NPIIE_ARTOC Probable neutral protease 2 homolog MCYG_01991 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_01991 PE=3 SV=1 47 334 2.0E-20
sp|Q2KH28|NPIIA_MAGO7 Neutral protease 2 homolog MGG_10927 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGCH7_ch7g157 PE=3 SV=1 37 337 3.0E-20
sp|E3QWD3|NPIIA_COLGM Neutral protease 2 homolog MGG_10927 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_10315 PE=3 SV=1 13 338 4.0E-20
sp|Q0UCJ2|NPIIA_PHANO Neutral protease 2 homolog SNOG_10522 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_10522 PE=3 SV=1 48 340 5.0E-20
sp|D4AXC1|NPIIE_ARTBC Probable neutral protease 2 homolog ARB_00849 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00849 PE=3 SV=1 47 334 8.0E-20
sp|C5PE62|MEP2_COCP7 Neutral protease 2 homolog MEP2 OS=Coccidioides posadasii (strain C735) GN=MEP2 PE=3 SV=1 1 334 1.0E-19
sp|C1G1N6|NPIIA_PARBD Neutral protease 2 homolog PADG_00776 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00776 PE=3 SV=1 40 337 4.0E-19
sp|C5NZY5|MEP5_COCP7 Neutral protease 2 homolog MEP5 OS=Coccidioides posadasii (strain C735) GN=MEP5 PE=3 SV=2 31 340 2.0E-18
sp|D4D7X4|NPIIF_TRIVH Neutral protease 2 homolog TRV_03208 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03208 PE=3 SV=1 47 334 2.0E-18
sp|E4UYQ9|NPIIF_ARTGP Neutral protease 2 homolog MGYG_06241 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_06241 PE=3 SV=1 47 334 3.0E-18
sp|C0S3U8|NPIIA_PARBP Neutral protease 2 homolog PABG_02362 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02362 PE=3 SV=2 40 337 5.0E-18
sp|B8NWE1|NPIIB_ASPFN Neutral protease 2 homolog AFLA_119780 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_119780 PE=3 SV=1 82 337 6.0E-18
sp|O05485|EPRA1_AERHY Extracellular protease OS=Aeromonas hydrophila GN=eprA1 PE=3 SV=1 1 334 3.0E-17
sp|C5FWQ2|NPIID_ARTOC Probable neutral protease 2 homolog MCYG_07155 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07155 PE=3 SV=1 49 338 4.0E-16
sp|C5G8P3|NPIIA_AJEDR Neutral protease 2 homolog BDCG_00922 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_00922 PE=3 SV=1 49 336 6.0E-16
sp|C5JKQ0|NPIIA_AJEDS Neutral protease 2 homolog BDBG_03102 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_03102 PE=3 SV=1 49 336 8.0E-16
sp|C5PIJ9|MEP4_COCP7 Neutral protease 2 homolog MEP4 OS=Coccidioides posadasii (strain C735) GN=MEP4 PE=3 SV=1 47 334 5.0E-15
sp|P46073|MEP20_ASPFL Neutral protease 2 homolog mep20 OS=Aspergillus flavus GN=mep20 PE=1 SV=1 16 334 2.0E-12
sp|P81055|PLMP_PLEOS Peptidyl-Lys metalloendopeptidase OS=Pleurotus ostreatus GN=MEP PE=1 SV=1 171 334 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0008237 metallopeptidase activity No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 61.17 28.03 94.30
Initials Initials knots 6.22 2.53 9.91
Pileal_Stipeal_center Stage I stipe center 3.49 1.36 5.63
Pileal_Stipeal_shell Stage I stipe shell 4.27 1.72 6.81
DIF_stipe_center Stage II stipe center 4.60 1.85 7.35
DIF_stipe_shell Stage II stipe shell 4.30 1.72 6.89
DIF_stipe_skin Stage II stipe skin 3.58 1.40 5.76
DIF_cap_skin Stage II cap skin 3.47 1.34 5.60
DIF_cap_tissue Stage II cap tissue 3.79 1.47 6.10
DIF_gill_tissue Stage II gill tissue 3.28 1.26 5.29
YFB_stipe_center Young fruiting body stipe center 4.50 1.86 7.14
YFB_stipe_shell Young fruiting body stipe shell 3.44 1.32 5.55
YFB_stipe_skin Young fruiting body stipe skin 4.49 1.80 7.18
YFB_cap_skin Young fruiting body cap skin 3.66 1.44 5.88
YFB_cap_tissue Young fruiting body cap tissue 3.59 1.40 5.78
YFB_gill_tissue Young fruiting body gill tissue 3.05 1.10 5.00
YFB_veil Young fruiting body veil 3.60 1.41 5.79

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.546537 no
DIF_gill_tissue YFB_stipe_shell 0.954320 no
DIF_gill_tissue YFB_stipe_skin 0.567275 no
DIF_gill_tissue YFB_cap_skin 0.885402 no
DIF_gill_tissue YFB_cap_tissue 0.907340 no
DIF_gill_tissue YFB_gill_tissue 0.932378 no
DIF_gill_tissue YFB_veil 0.902960 no
YFB_stipe_center YFB_stipe_shell 0.625107 no
YFB_stipe_center YFB_stipe_skin 0.997093 no
YFB_stipe_center YFB_cap_skin 0.740066 no
YFB_stipe_center YFB_cap_tissue 0.703538 no
YFB_stipe_center YFB_gill_tissue 0.441575 no
YFB_stipe_center YFB_veil 0.711211 no
YFB_stipe_shell YFB_stipe_skin 0.645694 no
YFB_stipe_shell YFB_cap_skin 0.938065 no
YFB_stipe_shell YFB_cap_tissue 0.956799 no
YFB_stipe_shell YFB_gill_tissue 0.875057 no
YFB_stipe_shell YFB_veil 0.954759 no
YFB_stipe_skin YFB_cap_skin 0.752207 no
YFB_stipe_skin YFB_cap_tissue 0.717648 no
YFB_stipe_skin YFB_gill_tissue 0.461123 no
YFB_stipe_skin YFB_veil 0.725159 no
YFB_cap_skin YFB_cap_tissue 0.980378 no
YFB_cap_skin YFB_gill_tissue 0.786482 no
YFB_cap_skin YFB_veil 0.984070 no
YFB_cap_tissue YFB_gill_tissue 0.816663 no
YFB_cap_tissue YFB_veil 0.996520 no
YFB_gill_tissue YFB_veil 0.813046 no
Initials DIF_gill_tissue 0.122022 no
Initials YFB_stipe_center 0.527537 no
Initials YFB_stipe_shell 0.166579 no
Initials YFB_stipe_skin 0.543603 no
Initials YFB_cap_skin 0.234848 no
Initials YFB_cap_tissue 0.201976 no
Initials YFB_gill_tissue 0.091330 no
Initials YFB_veil 0.213061 no
Initials Pileal_Stipeal_center 0.180575 no
Initials Pileal_Stipeal_shell 0.457845 no
Initials DIF_stipe_center 0.591550 no
Initials DIF_stipe_shell 0.470451 no
Initials DIF_stipe_skin 0.205177 no
Initials DIF_cap_skin 0.175547 no
Initials DIF_cap_tissue 0.273845 no
Pileal_Stipeal_center DIF_gill_tissue 0.939205 no
Pileal_Stipeal_center YFB_stipe_center 0.659199 no
Pileal_Stipeal_center YFB_stipe_shell 0.984924 no
Pileal_Stipeal_center YFB_stipe_skin 0.675621 no
Pileal_Stipeal_center YFB_cap_skin 0.955804 no
Pileal_Stipeal_center YFB_cap_tissue 0.974372 no
Pileal_Stipeal_center YFB_gill_tissue 0.854327 no
Pileal_Stipeal_center YFB_veil 0.971728 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.758030 no
Pileal_Stipeal_center DIF_stipe_center 0.641820 no
Pileal_Stipeal_center DIF_stipe_shell 0.741202 no
Pileal_Stipeal_center DIF_stipe_skin 0.977284 no
Pileal_Stipeal_center DIF_cap_skin 0.994382 no
Pileal_Stipeal_center DIF_cap_tissue 0.919450 no
Pileal_Stipeal_shell DIF_gill_tissue 0.655782 no
Pileal_Stipeal_shell YFB_stipe_center 0.945480 no
Pileal_Stipeal_shell YFB_stipe_shell 0.728343 no
Pileal_Stipeal_shell YFB_stipe_skin 0.949675 no
Pileal_Stipeal_shell YFB_cap_skin 0.828555 no
Pileal_Stipeal_shell YFB_cap_tissue 0.795383 no
Pileal_Stipeal_shell YFB_gill_tissue 0.549248 no
Pileal_Stipeal_shell YFB_veil 0.802540 no
Pileal_Stipeal_shell DIF_stipe_center 0.924048 no
Pileal_Stipeal_shell DIF_stipe_shell 0.991102 no
Pileal_Stipeal_shell DIF_stipe_skin 0.792599 no
Pileal_Stipeal_shell DIF_cap_skin 0.747052 no
Pileal_Stipeal_shell DIF_cap_tissue 0.872033 no
DIF_stipe_center DIF_gill_tissue 0.525830 no
DIF_stipe_center YFB_stipe_center 0.977284 no
DIF_stipe_center YFB_stipe_shell 0.602202 no
DIF_stipe_center YFB_stipe_skin 0.977062 no
DIF_stipe_center YFB_cap_skin 0.712799 no
DIF_stipe_center YFB_cap_tissue 0.678365 no
DIF_stipe_center YFB_gill_tissue 0.425535 no
DIF_stipe_center YFB_veil 0.686487 no
DIF_stipe_center DIF_stipe_shell 0.933113 no
DIF_stipe_center DIF_stipe_skin 0.672936 no
DIF_stipe_center DIF_cap_skin 0.624376 no
DIF_stipe_center DIF_cap_tissue 0.763026 no
DIF_stipe_shell DIF_gill_tissue 0.637149 no
DIF_stipe_shell YFB_stipe_center 0.955317 no
DIF_stipe_shell YFB_stipe_shell 0.711643 no
DIF_stipe_shell YFB_stipe_skin 0.959412 no
DIF_stipe_shell YFB_cap_skin 0.815431 no
DIF_stipe_shell YFB_cap_tissue 0.779500 no
DIF_stipe_shell YFB_gill_tissue 0.528239 no
DIF_stipe_shell YFB_veil 0.787532 no
DIF_stipe_shell DIF_stipe_skin 0.776785 no
DIF_stipe_shell DIF_cap_skin 0.730423 no
DIF_stipe_shell DIF_cap_tissue 0.859779 no
DIF_stipe_skin DIF_gill_tissue 0.908964 no
DIF_stipe_skin YFB_stipe_center 0.699037 no
DIF_stipe_skin YFB_stipe_shell 0.960150 no
DIF_stipe_skin YFB_stipe_skin 0.713522 no
DIF_stipe_skin YFB_cap_skin 0.976817 no
DIF_stipe_skin YFB_cap_tissue 0.996589 no
DIF_stipe_skin YFB_gill_tissue 0.820357 no
DIF_stipe_skin YFB_veil 0.992680 no
DIF_stipe_skin DIF_cap_skin 0.970487 no
DIF_stipe_skin DIF_cap_tissue 0.943093 no
DIF_cap_skin DIF_gill_tissue 0.945195 no
DIF_cap_skin YFB_stipe_center 0.651288 no
DIF_cap_skin YFB_stipe_shell 0.990426 no
DIF_cap_skin YFB_stipe_skin 0.667749 no
DIF_cap_skin YFB_cap_skin 0.949986 no
DIF_cap_skin YFB_cap_tissue 0.967761 no
DIF_cap_skin YFB_gill_tissue 0.864344 no
DIF_cap_skin YFB_veil 0.965639 no
DIF_cap_skin DIF_cap_tissue 0.912629 no
DIF_cap_tissue DIF_gill_tissue 0.839597 no
DIF_cap_tissue YFB_stipe_center 0.791842 no
DIF_cap_tissue YFB_stipe_shell 0.899402 no
DIF_cap_tissue YFB_stipe_skin 0.804361 no
DIF_cap_tissue YFB_cap_skin 0.969357 no
DIF_cap_tissue YFB_cap_tissue 0.948976 no
DIF_cap_tissue YFB_gill_tissue 0.738941 no
DIF_cap_tissue YFB_veil 0.952868 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|066130
MLFRPLVALTLFGIALANPIKRAENLEVAVTGPASSVKSIDELKFTSTVTNTGAEAVKVLKYGTILDELPTRSFK
VTKDGQDVEFKGVKMTIDLNDDAYTVIQPGQTITTVHDVAQLFDFESAGAGKFSFEALTLFPMANEAALTKVQAA
APSVEVEVTEDVATRQIVKRATNVCNSSSLRSYIDAAYSEGRQLASVAASYISSRGTGDSLYRSYWGTNSASTVG
GVFNRVVSGGSSTLNCNDAFGVCDGNVIAYTLTSTGNIYFCSIFYNEVANGNLCSGTSVASRNVRGGTVLHELTH
ATSGTDDVIYGCASDQGLSNSQKVNNADNYNCFSTQVYQNTQC*
Coding >AgabiH97|066130
ATGCTCTTCCGTCCTCTCGTCGCTCTCACCCTTTTCGGTATCGCTCTCGCCAACCCCATCAAGAGGGCTGAAAAC
CTTGAGGTTGCCGTTACTGGACCCGCCAGCAGCGTCAAATCGATTGATGAGCTCAAGTTCACTTCGACGGTCACC
AACACCGGTGCTGAGGCTGTCAAGGTCTTGAAGTACGGCACTATCTTGGACGAACTGCCGACTAGGTCGTTCAAG
GTCACAAAAGATGGCCAGGACGTCGAATTCAAGGGTGTCAAGATGACAATCGACTTGAACGATGACGCCTACACC
GTTATCCAACCTGGACAGACGATCACCACTGTTCATGATGTTGCTCAACTCTTCGATTTCGAGTCTGCCGGTGCT
GGAAAATTCTCTTTCGAGGCCTTGACTCTCTTCCCGATGGCAAATGAAGCCGCTCTCACCAAAGTTCAAGCCGCT
GCTCCTTCTGTTGAGGTCGAAGTCACTGAAGATGTTGCCACCCGCCAAATCGTCAAGCGTGCGACCAACGTCTGC
AATTCGTCTTCGTTGAGGTCTTACATTGATGCTGCCTACTCCGAAGGCAGGCAATTGGCATCCGTCGCTGCCAGC
TACATCAGTAGCCGTGGAACTGGTGACTCTCTGTACAGGAGTTACTGGGGTACCAACTCTGCTTCTACTGTAGGT
GGTGTCTTCAACAGAGTTGTAAGCGGAGGATCGTCCACTTTGAACTGCAATGATGCATTCGGTGTTTGTGACGGA
AATGTTATCGCCTACACTCTTACCTCCACCGGCAACATTTACTTCTGTAGCATCTTCTACAACGAAGTAGCTAAC
GGAAACCTTTGCTCTGGAACATCTGTAGCTTCTCGTAACGTCCGTGGTGGCACCGTCTTGCACGAGCTCACTCAC
GCCACTTCGGGAACTGACGACGTTATCTACGGTTGTGCCTCTGATCAAGGTCTTTCCAACTCTCAAAAGGTCAAC
AACGCTGACAACTACAACTGCTTCTCCACTCAAGTTTACCAGAACACCCAGTGCTGA
Transcript >AgabiH97|066130
ATGCTCTTCCGTCCTCTCGTCGCTCTCACCCTTTTCGGTATCGCTCTCGCCAACCCCATCAAGAGGGCTGAAAAC
CTTGAGGTTGCCGTTACTGGACCCGCCAGCAGCGTCAAATCGATTGATGAGCTCAAGTTCACTTCGACGGTCACC
AACACCGGTGCTGAGGCTGTCAAGGTCTTGAAGTACGGCACTATCTTGGACGAACTGCCGACTAGGTCGTTCAAG
GTCACAAAAGATGGCCAGGACGTCGAATTCAAGGGTGTCAAGATGACAATCGACTTGAACGATGACGCCTACACC
GTTATCCAACCTGGACAGACGATCACCACTGTTCATGATGTTGCTCAACTCTTCGATTTCGAGTCTGCCGGTGCT
GGAAAATTCTCTTTCGAGGCCTTGACTCTCTTCCCGATGGCAAATGAAGCCGCTCTCACCAAAGTTCAAGCCGCT
GCTCCTTCTGTTGAGGTCGAAGTCACTGAAGATGTTGCCACCCGCCAAATCGTCAAGCGTGCGACCAACGTCTGC
AATTCGTCTTCGTTGAGGTCTTACATTGATGCTGCCTACTCCGAAGGCAGGCAATTGGCATCCGTCGCTGCCAGC
TACATCAGTAGCCGTGGAACTGGTGACTCTCTGTACAGGAGTTACTGGGGTACCAACTCTGCTTCTACTGTAGGT
GGTGTCTTCAACAGAGTTGTAAGCGGAGGATCGTCCACTTTGAACTGCAATGATGCATTCGGTGTTTGTGACGGA
AATGTTATCGCCTACACTCTTACCTCCACCGGCAACATTTACTTCTGTAGCATCTTCTACAACGAAGTAGCTAAC
GGAAACCTTTGCTCTGGAACATCTGTAGCTTCTCGTAACGTCCGTGGTGGCACCGTCTTGCACGAGCTCACTCAC
GCCACTTCGGGAACTGACGACGTTATCTACGGTTGTGCCTCTGATCAAGGTCTTTCCAACTCTCAAAAGGTCAAC
AACGCTGACAACTACAACTGCTTCTCCACTCAAGTTTACCAGAACACCCAGTGCTGA
Gene >AgabiH97|066130
ATGCTCTTCCGTCCTCTCGTCGCTCTCACCCTTTTCGGTATCGCTCTCGCCAACCCCATCAAGAGGGCTGAAAAC
CTTGAGGTTGCCGTTACTGGACCCGCCAGCAGCGTCAAATCGATTGATGAGCTCAAGTTCACTTCGACGGTCACC
AACACCGGTGCTGAGGCTGTCAAGGTCTTGAAGTACGGCACTATCTTGGACGAACTGCCGACTAGGTCGTTCAAG
GTCACAAAAGATGGCCAGGACGTCGAATTCAAGGGTGTCAAGGTTTGTTATGGGCGTCGTAGTCAATATGCTTCA
AATTAACGAGGTTTCTCTTCTAGATGACAATCGACTTGAACGATGACGCCTACACCGTTATCCAACCTGGACAGA
CGATCACCACTGTTCATGATGGTAAGTCAGGTAGCTTTTACTCTCGAGAGCGACCTCATTGACGTGTACAATCAT
TAGTTGCTCAACTCTTCGATTTCGAGTCTGCCGGTGCTGGAAAATTCTCTTTCGAGGCCTTGACTCTCTTCCCGA
TGGCAAATGAAGCCGCTCTCACCAAAGTTCAAGCCGCTGCTCCTTCTGTTGAGGTCGAAGTCACTGAAGATGTTG
CCACCCGCCAAATCGTCAAGCGTGCGACCAACGTCTGCAATTCGTCTTCGTTGAGGTCTTACATTGATGCTGCCT
ACTCCGAAGGCAGGCAATTGGCATCCGTCGCTGCCAGCTACATCAGTAGCCGTGGAACTGGTGACTCTCTGTACA
GGAGTTACTGGGGTACCAACTCTGCTTCTACTGTAGGTGGTGTCTTCAACAGAGTTGTAAGCGGAGGATCGTCCA
CGTAAGTGATACTTGTTTAATTTCGGGTAATTGGGAAGTCACATCTAATGAACAATTATCCGCCTTGTAGTTTGA
ACTGCAATGATGCATTCGGTGTTTGTGACGGAAATGTTATCGCCTACACTCTTACCTCCACCGGCAACGTGAGCA
CAACAAAAACCTTTTTCATCTATTTCAAACCTGATTGTTTTTCCTCGAATAGATTTACTTCTGTAGCATCTTCTA
CAACGAAGTAGCTAACGGAAACCTTTGCTCTGGAACATCTGTAGCTTCTCGTAACGTCCGTGGTGGCACCGTCTT
GCACGAGGTAAGCGACCTTTCGAATTCATACATAAGCTGTGATAACTTGATATTGATATAACTGTGCCATATAGC
TCACTCACGCCACTTCGGGAACTGACGACGTTATCTACGGTTGTGCCTCTGATCAAGGTCTTTCCAACTCTCAAA
AGGTCAACAACGCTGACAACTACAACGTTAGTCGTTTTTCTTCTCTTCCATTAATATCCATTGCTGACTTCTATT
TCTTTTCTCTCTTCAACTAGTGCTTCTCCACTCAAGTTTACCAGAACACCCAGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail