Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|066130
Gene name
Locationscaffold_4:184329..185738
Strand+
Gene length (bp)1409
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02102 Peptidase_M35 Deuterolysin metalloprotease (M35) family 1.5E-34 10 335
PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase 1.6E-22 204 334
PF13933 HRXXH Putative peptidase family 4.2E-10 156 339

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5FR79|NPIIA_ARTOC Probable neutral protease 2 homolog MCYG_05201 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_05201 PE=3 SV=1 49 336 1.0E-30
sp|E4UR63|NPIIC_ARTGP Neutral protease 2 homolog MGYG_02351 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02351 PE=3 SV=1 25 338 9.0E-28
sp|C5NZL6|MEP8_COCP7 Neutral protease 2 homolog MEP8 OS=Coccidioides posadasii (strain C735) GN=MEP8 PE=3 SV=1 36 334 3.0E-26
sp|C5P3T4|MEP7_COCP7 Neutral protease 2 homolog MEP7 OS=Coccidioides posadasii (strain C735) GN=MEP7 PE=3 SV=1 37 339 4.0E-26
sp|Q09016|MEP20_ASPFM Neutral protease 2 homolog mep20 OS=Neosartorya fumigata GN=mep20 PE=3 SV=1 9 334 4.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5FR79|NPIIA_ARTOC Probable neutral protease 2 homolog MCYG_05201 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_05201 PE=3 SV=1 49 336 1.0E-30
sp|E4UR63|NPIIC_ARTGP Neutral protease 2 homolog MGYG_02351 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02351 PE=3 SV=1 25 338 9.0E-28
sp|C5NZL6|MEP8_COCP7 Neutral protease 2 homolog MEP8 OS=Coccidioides posadasii (strain C735) GN=MEP8 PE=3 SV=1 36 334 3.0E-26
sp|C5P3T4|MEP7_COCP7 Neutral protease 2 homolog MEP7 OS=Coccidioides posadasii (strain C735) GN=MEP7 PE=3 SV=1 37 339 4.0E-26
sp|Q09016|MEP20_ASPFM Neutral protease 2 homolog mep20 OS=Neosartorya fumigata GN=mep20 PE=3 SV=1 9 334 4.0E-26
sp|D4DGR5|NPIIC_TRIVH Probable neutral protease 2 homolog TRV_06370 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06370 PE=3 SV=1 47 334 6.0E-26
sp|D4AM79|NPIIC_ARTBC Probable neutral protease 2 homolog ARB_04769 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04769 PE=3 SV=1 47 334 6.0E-26
sp|C4JH04|NPIIC_UNCRE Neutral protease 2 homolog UREG_01255 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01255 PE=3 SV=1 44 337 8.0E-26
sp|C0IPP1|NPIIA_TRIRU Probable neutral protease 2 homolog A OS=Trichophyton rubrum GN=NpII-A PE=3 SV=1 47 338 3.0E-25
sp|D4B639|NPIID_ARTBC Probable neutral protease 2 homolog ARB_03949 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03949 PE=3 SV=1 47 338 4.0E-25
sp|D4D616|NPIID_TRIVH Probable neutral protease 2 homolog TRV_02539 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02539 PE=3 SV=1 47 338 7.0E-25
sp|B0Y4X9|NPIIB_ASPFC Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_070680 PE=3 SV=1 9 334 8.0E-25
sp|Q2UP30|NPIIA_ASPOR Neutral protease 2 homolog AO090001000135 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090001000135 PE=3 SV=1 44 340 9.0E-25
sp|Q4WQR6|NPIIA_ASPFU Neutral protease 2 homolog AFUA_4G13750 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G13750 PE=3 SV=1 9 334 1.0E-24
sp|C0IPP2|NPIIB_TRIRU Probable neutral protease 2 homolog B OS=Trichophyton rubrum GN=NpII-B PE=3 SV=1 47 338 2.0E-24
sp|C5FCA7|NPIIB_ARTOC Probable neutral protease 2 homolog MCYG_00239 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_00239 PE=3 SV=1 47 338 2.0E-24
sp|P47189|PLNC_PENCI Penicillolysin OS=Penicillium citrinum GN=plnC PE=1 SV=1 36 337 2.0E-24
sp|Q4WA45|NPIIC_ASPFU Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G02700 PE=3 SV=3 36 342 3.0E-24
sp|E4US45|NPIID_ARTGP Neutral protease 2 homolog MGYG_03465 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03465 PE=3 SV=1 47 340 4.0E-24
sp|P46076|NPII_ASPOR Neutral protease 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090010000493 PE=1 SV=2 33 337 8.0E-24
sp|A1CVX6|NPIIB_NEOFI Neutral protease 2 homolog NFIA_102630 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_102630 PE=3 SV=1 9 334 8.0E-24
sp|Q9Y7F7|PLMP_ARMME Peptidyl-Lys metalloendopeptidase OS=Armillaria mellea GN=MEP PE=1 SV=1 6 334 2.0E-23
sp|D4ANL2|NPIIB_ARTBC Probable neutral protease 2 homolog ARB_05817 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05817 PE=3 SV=1 47 334 2.0E-23
sp|B8NJB2|NPIIA_ASPFN Neutral protease 2 homolog AFLA_065450 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_065450 PE=3 SV=1 19 338 2.0E-23
sp|A1DA48|NPIIA_NEOFI Neutral protease 2 homolog NFIA_031120 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_031120 PE=3 SV=1 36 342 3.0E-23
sp|D4DE03|NPIIB_TRIVH Probable neutral protease 2 homolog TRV_05367 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05367 PE=3 SV=1 47 334 4.0E-23
sp|B0YEV0|NPIIA_ASPFC Neutral protease 2 homolog AFUB_100460 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_100460 PE=3 SV=2 36 334 5.0E-23
sp|Q5AUR8|NPIIA_EMENI Neutral protease 2 homolog AN7962 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7962 PE=3 SV=1 5 338 6.0E-23
sp|A7F811|NPIIA_SCLS1 Neutral protease 2 homolog SS1G_13741 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_13741 PE=3 SV=1 47 338 1.0E-22
sp|C5PE18|MEP6_COCP7 Neutral protease 2 homolog MEP6 OS=Coccidioides posadasii (strain C735) GN=MEP6 PE=3 SV=1 6 340 2.0E-22
sp|A1CIU4|NPIIA_ASPCL Neutral protease 2 homolog ACLA_052720 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_052720 PE=3 SV=1 9 340 3.0E-22
sp|Q0V1D7|NPIIB_PHANO Neutral protease 2 homolog SNOG_02177 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02177 PE=3 SV=1 36 343 3.0E-22
sp|C4JLQ3|NPIIA_UNCRE Neutral protease 2 homolog UREG_03761 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_03761 PE=3 SV=1 6 334 4.0E-22
sp|E4UUX3|NPIIA_ARTGP Neutral protease 2 homolog MGYG_04094 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_04094 PE=3 SV=1 47 338 6.0E-22
sp|C5FPC2|NPIIC_ARTOC Probable neutral protease 2 homolog MCYG_04257 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04257 PE=3 SV=1 47 338 7.0E-22
sp|Q5B7T7|NPIIB_EMENI Neutral protease 2 homolog AN3393 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3393 PE=3 SV=1 25 337 1.0E-21
sp|A6SBW7|NPIIA_BOTFB Neutral protease 2 homolog SNOG_10522 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_10098 PE=3 SV=1 47 338 1.0E-21
sp|C5P507|MEP3_COCP7 Neutral protease 2 homolog MEP3 OS=Coccidioides posadasii (strain C735) GN=MEP3 PE=3 SV=1 6 337 2.0E-21
sp|E5R1Z3|NPIIB_ARTGP Neutral protease 2 homolog MGYG_00813 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00813 PE=3 SV=1 47 334 2.0E-21
sp|C5JHY1|NPIIB_AJEDS Neutral protease 2 homolog BDBG_02110 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_02110 PE=3 SV=1 21 340 3.0E-21
sp|Q0CMZ3|NPIIA_ASPTN Neutral protease 2 homolog ATEG_04941 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_04941 PE=3 SV=1 16 340 3.0E-21
sp|P81054|PLMP_GRIFR Peptidyl-Lys metalloendopeptidase OS=Grifola frondosa GN=MEP PE=1 SV=2 1 334 7.0E-21
sp|D4AJ87|NPIIF_ARTBC Neutral protease 2 homolog ARB_04336 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04336 PE=3 SV=1 47 334 2.0E-20
sp|C4JK49|NPIIB_UNCRE Neutral protease 2 homolog UREG_02006 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_02006 PE=3 SV=1 37 337 2.0E-20
sp|C5FIT1|NPIIE_ARTOC Probable neutral protease 2 homolog MCYG_01991 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_01991 PE=3 SV=1 47 334 2.0E-20
sp|Q2KH28|NPIIA_MAGO7 Neutral protease 2 homolog MGG_10927 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGCH7_ch7g157 PE=3 SV=1 37 337 3.0E-20
sp|E3QWD3|NPIIA_COLGM Neutral protease 2 homolog MGG_10927 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_10315 PE=3 SV=1 13 338 4.0E-20
sp|Q0UCJ2|NPIIA_PHANO Neutral protease 2 homolog SNOG_10522 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_10522 PE=3 SV=1 48 340 5.0E-20
sp|D4AXC1|NPIIE_ARTBC Probable neutral protease 2 homolog ARB_00849 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00849 PE=3 SV=1 47 334 8.0E-20
sp|C5PE62|MEP2_COCP7 Neutral protease 2 homolog MEP2 OS=Coccidioides posadasii (strain C735) GN=MEP2 PE=3 SV=1 1 334 1.0E-19
sp|C1G1N6|NPIIA_PARBD Neutral protease 2 homolog PADG_00776 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00776 PE=3 SV=1 40 337 4.0E-19
sp|C5NZY5|MEP5_COCP7 Neutral protease 2 homolog MEP5 OS=Coccidioides posadasii (strain C735) GN=MEP5 PE=3 SV=2 31 340 2.0E-18
sp|D4D7X4|NPIIF_TRIVH Neutral protease 2 homolog TRV_03208 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03208 PE=3 SV=1 47 334 2.0E-18
sp|E4UYQ9|NPIIF_ARTGP Neutral protease 2 homolog MGYG_06241 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_06241 PE=3 SV=1 47 334 3.0E-18
sp|C0S3U8|NPIIA_PARBP Neutral protease 2 homolog PABG_02362 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02362 PE=3 SV=2 40 337 5.0E-18
sp|B8NWE1|NPIIB_ASPFN Neutral protease 2 homolog AFLA_119780 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_119780 PE=3 SV=1 82 337 6.0E-18
sp|O05485|EPRA1_AERHY Extracellular protease OS=Aeromonas hydrophila GN=eprA1 PE=3 SV=1 1 334 3.0E-17
sp|C5FWQ2|NPIID_ARTOC Probable neutral protease 2 homolog MCYG_07155 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07155 PE=3 SV=1 49 338 4.0E-16
sp|C5G8P3|NPIIA_AJEDR Neutral protease 2 homolog BDCG_00922 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_00922 PE=3 SV=1 49 336 6.0E-16
sp|C5JKQ0|NPIIA_AJEDS Neutral protease 2 homolog BDBG_03102 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_03102 PE=3 SV=1 49 336 8.0E-16
sp|C5PIJ9|MEP4_COCP7 Neutral protease 2 homolog MEP4 OS=Coccidioides posadasii (strain C735) GN=MEP4 PE=3 SV=1 47 334 5.0E-15
sp|P46073|MEP20_ASPFL Neutral protease 2 homolog mep20 OS=Aspergillus flavus GN=mep20 PE=1 SV=1 16 334 2.0E-12
sp|P81055|PLMP_PLEOS Peptidyl-Lys metalloendopeptidase OS=Pleurotus ostreatus GN=MEP PE=1 SV=1 171 334 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0008237 metallopeptidase activity No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|066130
MLFRPLVALTLFGIALANPIKRAENLEVAVTGPASSVKSIDELKFTSTVTNTGAEAVKVLKYGTILDELPTRSFK
VTKDGQDVEFKGVKMTIDLNDDAYTVIQPGQTITTVHDVAQLFDFESAGAGKFSFEALTLFPMANEAALTKVQAA
APSVEVEVTEDVATRQIVKRATNVCNSSSLRSYIDAAYSEGRQLASVAASYISSRGTGDSLYRSYWGTNSASTVG
GVFNRVVSGGSSTLNCNDAFGVCDGNVIAYTLTSTGNIYFCSIFYNEVANGNLCSGTSVASRNVRGGTVLHELTH
ATSGTDDVIYGCASDQGLSNSQKVNNADNYNCFSTQVYQNTQC*
Coding >AgabiH97|066130
ATGCTCTTCCGTCCTCTCGTCGCTCTCACCCTTTTCGGTATCGCTCTCGCCAACCCCATCAAGAGGGCTGAAAAC
CTTGAGGTTGCCGTTACTGGACCCGCCAGCAGCGTCAAATCGATTGATGAGCTCAAGTTCACTTCGACGGTCACC
AACACCGGTGCTGAGGCTGTCAAGGTCTTGAAGTACGGCACTATCTTGGACGAACTGCCGACTAGGTCGTTCAAG
GTCACAAAAGATGGCCAGGACGTCGAATTCAAGGGTGTCAAGATGACAATCGACTTGAACGATGACGCCTACACC
GTTATCCAACCTGGACAGACGATCACCACTGTTCATGATGTTGCTCAACTCTTCGATTTCGAGTCTGCCGGTGCT
GGAAAATTCTCTTTCGAGGCCTTGACTCTCTTCCCGATGGCAAATGAAGCCGCTCTCACCAAAGTTCAAGCCGCT
GCTCCTTCTGTTGAGGTCGAAGTCACTGAAGATGTTGCCACCCGCCAAATCGTCAAGCGTGCGACCAACGTCTGC
AATTCGTCTTCGTTGAGGTCTTACATTGATGCTGCCTACTCCGAAGGCAGGCAATTGGCATCCGTCGCTGCCAGC
TACATCAGTAGCCGTGGAACTGGTGACTCTCTGTACAGGAGTTACTGGGGTACCAACTCTGCTTCTACTGTAGGT
GGTGTCTTCAACAGAGTTGTAAGCGGAGGATCGTCCACTTTGAACTGCAATGATGCATTCGGTGTTTGTGACGGA
AATGTTATCGCCTACACTCTTACCTCCACCGGCAACATTTACTTCTGTAGCATCTTCTACAACGAAGTAGCTAAC
GGAAACCTTTGCTCTGGAACATCTGTAGCTTCTCGTAACGTCCGTGGTGGCACCGTCTTGCACGAGCTCACTCAC
GCCACTTCGGGAACTGACGACGTTATCTACGGTTGTGCCTCTGATCAAGGTCTTTCCAACTCTCAAAAGGTCAAC
AACGCTGACAACTACAACTGCTTCTCCACTCAAGTTTACCAGAACACCCAGTGCTGA
Transcript >AgabiH97|066130
ATGCTCTTCCGTCCTCTCGTCGCTCTCACCCTTTTCGGTATCGCTCTCGCCAACCCCATCAAGAGGGCTGAAAAC
CTTGAGGTTGCCGTTACTGGACCCGCCAGCAGCGTCAAATCGATTGATGAGCTCAAGTTCACTTCGACGGTCACC
AACACCGGTGCTGAGGCTGTCAAGGTCTTGAAGTACGGCACTATCTTGGACGAACTGCCGACTAGGTCGTTCAAG
GTCACAAAAGATGGCCAGGACGTCGAATTCAAGGGTGTCAAGATGACAATCGACTTGAACGATGACGCCTACACC
GTTATCCAACCTGGACAGACGATCACCACTGTTCATGATGTTGCTCAACTCTTCGATTTCGAGTCTGCCGGTGCT
GGAAAATTCTCTTTCGAGGCCTTGACTCTCTTCCCGATGGCAAATGAAGCCGCTCTCACCAAAGTTCAAGCCGCT
GCTCCTTCTGTTGAGGTCGAAGTCACTGAAGATGTTGCCACCCGCCAAATCGTCAAGCGTGCGACCAACGTCTGC
AATTCGTCTTCGTTGAGGTCTTACATTGATGCTGCCTACTCCGAAGGCAGGCAATTGGCATCCGTCGCTGCCAGC
TACATCAGTAGCCGTGGAACTGGTGACTCTCTGTACAGGAGTTACTGGGGTACCAACTCTGCTTCTACTGTAGGT
GGTGTCTTCAACAGAGTTGTAAGCGGAGGATCGTCCACTTTGAACTGCAATGATGCATTCGGTGTTTGTGACGGA
AATGTTATCGCCTACACTCTTACCTCCACCGGCAACATTTACTTCTGTAGCATCTTCTACAACGAAGTAGCTAAC
GGAAACCTTTGCTCTGGAACATCTGTAGCTTCTCGTAACGTCCGTGGTGGCACCGTCTTGCACGAGCTCACTCAC
GCCACTTCGGGAACTGACGACGTTATCTACGGTTGTGCCTCTGATCAAGGTCTTTCCAACTCTCAAAAGGTCAAC
AACGCTGACAACTACAACTGCTTCTCCACTCAAGTTTACCAGAACACCCAGTGCTGA
Gene >AgabiH97|066130
ATGCTCTTCCGTCCTCTCGTCGCTCTCACCCTTTTCGGTATCGCTCTCGCCAACCCCATCAAGAGGGCTGAAAAC
CTTGAGGTTGCCGTTACTGGACCCGCCAGCAGCGTCAAATCGATTGATGAGCTCAAGTTCACTTCGACGGTCACC
AACACCGGTGCTGAGGCTGTCAAGGTCTTGAAGTACGGCACTATCTTGGACGAACTGCCGACTAGGTCGTTCAAG
GTCACAAAAGATGGCCAGGACGTCGAATTCAAGGGTGTCAAGGTTTGTTATGGGCGTCGTAGTCAATATGCTTCA
AATTAACGAGGTTTCTCTTCTAGATGACAATCGACTTGAACGATGACGCCTACACCGTTATCCAACCTGGACAGA
CGATCACCACTGTTCATGATGGTAAGTCAGGTAGCTTTTACTCTCGAGAGCGACCTCATTGACGTGTACAATCAT
TAGTTGCTCAACTCTTCGATTTCGAGTCTGCCGGTGCTGGAAAATTCTCTTTCGAGGCCTTGACTCTCTTCCCGA
TGGCAAATGAAGCCGCTCTCACCAAAGTTCAAGCCGCTGCTCCTTCTGTTGAGGTCGAAGTCACTGAAGATGTTG
CCACCCGCCAAATCGTCAAGCGTGCGACCAACGTCTGCAATTCGTCTTCGTTGAGGTCTTACATTGATGCTGCCT
ACTCCGAAGGCAGGCAATTGGCATCCGTCGCTGCCAGCTACATCAGTAGCCGTGGAACTGGTGACTCTCTGTACA
GGAGTTACTGGGGTACCAACTCTGCTTCTACTGTAGGTGGTGTCTTCAACAGAGTTGTAAGCGGAGGATCGTCCA
CGTAAGTGATACTTGTTTAATTTCGGGTAATTGGGAAGTCACATCTAATGAACAATTATCCGCCTTGTAGTTTGA
ACTGCAATGATGCATTCGGTGTTTGTGACGGAAATGTTATCGCCTACACTCTTACCTCCACCGGCAACGTGAGCA
CAACAAAAACCTTTTTCATCTATTTCAAACCTGATTGTTTTTCCTCGAATAGATTTACTTCTGTAGCATCTTCTA
CAACGAAGTAGCTAACGGAAACCTTTGCTCTGGAACATCTGTAGCTTCTCGTAACGTCCGTGGTGGCACCGTCTT
GCACGAGGTAAGCGACCTTTCGAATTCATACATAAGCTGTGATAACTTGATATTGATATAACTGTGCCATATAGC
TCACTCACGCCACTTCGGGAACTGACGACGTTATCTACGGTTGTGCCTCTGATCAAGGTCTTTCCAACTCTCAAA
AGGTCAACAACGCTGACAACTACAACGTTAGTCGTTTTTCTTCTCTTCCATTAATATCCATTGCTGACTTCTATT
TCTTTTCTCTCTTCAACTAGTGCTTCTCCACTCAAGTTTACCAGAACACCCAGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail