Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|066010
Gene name
Locationscaffold_4:153090..155031
Strand+
Gene length (bp)1941
Transcript length (bp)1665
Coding sequence length (bp)1665
Protein length (aa) 555

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19977 xRRM xRRM domain 1.4E-36 368 493

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:1904868 telomerase catalytic core complex assembly Yes
GO:0070034 telomerase RNA binding Yes
GO:0003676 nucleic acid binding No
GO:0071840 cellular component organization or biogenesis No
GO:0071826 ribonucleoprotein complex subunit organization No
GO:0043933 protein-containing complex organization No
GO:1905323 telomerase holoenzyme complex assembly No
GO:0009987 cellular process No
GO:0003723 RNA binding No
GO:0008150 biological_process No
GO:0065003 protein-containing complex assembly No
GO:1901363 heterocyclic compound binding No
GO:0016043 cellular component organization No
GO:0097159 organic cyclic compound binding No
GO:0022618 ribonucleoprotein complex assembly No
GO:0005488 binding No
GO:0022607 cellular component assembly No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|066010
MSSLAFIPRKLTKSAPAKDKKHTSKRDEDHSSSKPVPTLPAVPAPDDVPNKYNDQDYANLITLSLSDYVLWIDPD
LRRKFEVDSAGDQSYVSFDYLFEHSAALSSLLEVKHGKESSIVRSKIQAALVKGIRAHANDVFDVRLLLHSDAVV
PRFGKQKDLSGGYEIRRKRLGSLSKGKAEWDACTLYLENIPPGYRSYAAIIRFLSDLLHDAPPVPSSSTLSADLL
ARVQGISFPAHYNDKLGARPTCKGFALVTFAHATDVEYLQSFFPWIANENNERGGKGKQAEATAESIHAAIQSKF
RVTTKKHWLELKAEYLAYRQRLVEEINAHQDARRDAQTHSQEPMAVSPPTASTSIQHPSSTQLTSFSPYPPDCLL
LVKNVHPDTTKTTLRTLFSQAFHSLDQKGVDGLGYVDFNKGMDRCYLRLAAPMYANLLVDHFDHHLRQIIQVSGM
DESGVDIRTAETSIPKDLQPISVERVIGRPEEIYWEKVPAKVRKTAVEHAIQLMTLSRSEDRDTNHSHTRKHGRV
GSQDGGAPRTNNLVSINQASYPYRCCRST*
Coding >AgabiH97|066010
ATGTCCTCGCTCGCCTTCATACCTAGAAAACTCACCAAGTCAGCGCCTGCGAAAGACAAAAAACACACCTCAAAG
CGCGACGAGGACCATTCTTCTTCTAAACCTGTACCAACACTACCAGCGGTCCCTGCTCCAGACGACGTACCAAAC
AAGTATAACGATCAAGACTACGCGAATCTCATTACTTTGTCACTTTCGGACTATGTGTTATGGATCGACCCGGAC
CTTAGAAGAAAGTTCGAAGTTGATTCAGCCGGTGACCAAAGTTACGTGTCTTTTGACTATCTGTTCGAACACTCT
GCCGCGCTTTCAAGCCTTTTGGAAGTTAAACATGGAAAAGAATCTAGCATAGTGCGAAGCAAAATTCAGGCCGCC
TTAGTCAAAGGCATTCGAGCACACGCGAATGATGTTTTCGACGTTCGGCTACTCCTTCACTCGGATGCAGTAGTA
CCGCGTTTTGGTAAACAAAAGGACCTTTCTGGAGGTTATGAAATCAGACGGAAGCGGCTAGGATCACTGTCGAAG
GGTAAAGCCGAGTGGGACGCGTGCACGCTATATCTGGAAAACATACCTCCGGGATATCGATCTTATGCTGCCATT
ATACGGTTTCTGAGCGACTTGTTACATGATGCCCCACCCGTTCCCTCATCATCGACACTATCTGCCGATCTTCTT
GCACGCGTTCAAGGCATATCCTTCCCTGCTCACTATAACGACAAACTTGGTGCGCGGCCGACTTGCAAAGGGTTT
GCGCTCGTGACATTTGCACATGCAACAGACGTAGAATATCTGCAGAGTTTCTTCCCGTGGATTGCTAATGAAAAT
AACGAACGCGGTGGAAAGGGCAAACAAGCTGAGGCGACTGCCGAATCCATCCATGCGGCTATACAGTCCAAATTT
CGTGTGACAACGAAAAAACATTGGCTCGAGTTGAAGGCCGAATACTTGGCGTATAGGCAACGGCTTGTAGAAGAG
ATTAATGCTCATCAAGATGCGCGGAGAGATGCCCAGACTCATTCACAGGAACCCATGGCCGTCTCACCTCCTACG
GCGTCTACTTCTATACAACATCCTTCATCCACCCAATTAACTTCTTTTTCCCCATATCCTCCTGATTGCCTCCTC
CTTGTTAAAAATGTCCATCCGGATACCACCAAAACGACCTTACGAACCTTGTTCTCCCAGGCATTTCATTCACTC
GACCAAAAAGGTGTGGATGGATTGGGTTATGTCGACTTCAACAAGGGTATGGACAGATGCTACCTTCGGTTAGCT
GCACCCATGTACGCTAATCTACTCGTGGATCACTTCGACCATCACCTTCGCCAAATTATCCAAGTCTCAGGAATG
GATGAATCTGGTGTTGATATCCGTACAGCGGAAACATCTATACCCAAGGATCTCCAACCGATTTCTGTGGAACGC
GTCATCGGTAGGCCGGAAGAAATTTATTGGGAGAAAGTTCCTGCAAAAGTTAGGAAAACTGCTGTTGAGCATGCG
ATACAGCTTATGACGCTCAGTCGATCTGAAGACCGTGATACGAACCATAGTCATACACGCAAGCATGGAAGGGTG
GGTAGTCAAGATGGTGGTGCACCGAGAACGAATAACTTAGTTAGTATCAACCAAGCTTCGTACCCATACCGTTGC
TGCAGAAGCACTTGA
Transcript >AgabiH97|066010
ATGTCCTCGCTCGCCTTCATACCTAGAAAACTCACCAAGTCAGCGCCTGCGAAAGACAAAAAACACACCTCAAAG
CGCGACGAGGACCATTCTTCTTCTAAACCTGTACCAACACTACCAGCGGTCCCTGCTCCAGACGACGTACCAAAC
AAGTATAACGATCAAGACTACGCGAATCTCATTACTTTGTCACTTTCGGACTATGTGTTATGGATCGACCCGGAC
CTTAGAAGAAAGTTCGAAGTTGATTCAGCCGGTGACCAAAGTTACGTGTCTTTTGACTATCTGTTCGAACACTCT
GCCGCGCTTTCAAGCCTTTTGGAAGTTAAACATGGAAAAGAATCTAGCATAGTGCGAAGCAAAATTCAGGCCGCC
TTAGTCAAAGGCATTCGAGCACACGCGAATGATGTTTTCGACGTTCGGCTACTCCTTCACTCGGATGCAGTAGTA
CCGCGTTTTGGTAAACAAAAGGACCTTTCTGGAGGTTATGAAATCAGACGGAAGCGGCTAGGATCACTGTCGAAG
GGTAAAGCCGAGTGGGACGCGTGCACGCTATATCTGGAAAACATACCTCCGGGATATCGATCTTATGCTGCCATT
ATACGGTTTCTGAGCGACTTGTTACATGATGCCCCACCCGTTCCCTCATCATCGACACTATCTGCCGATCTTCTT
GCACGCGTTCAAGGCATATCCTTCCCTGCTCACTATAACGACAAACTTGGTGCGCGGCCGACTTGCAAAGGGTTT
GCGCTCGTGACATTTGCACATGCAACAGACGTAGAATATCTGCAGAGTTTCTTCCCGTGGATTGCTAATGAAAAT
AACGAACGCGGTGGAAAGGGCAAACAAGCTGAGGCGACTGCCGAATCCATCCATGCGGCTATACAGTCCAAATTT
CGTGTGACAACGAAAAAACATTGGCTCGAGTTGAAGGCCGAATACTTGGCGTATAGGCAACGGCTTGTAGAAGAG
ATTAATGCTCATCAAGATGCGCGGAGAGATGCCCAGACTCATTCACAGGAACCCATGGCCGTCTCACCTCCTACG
GCGTCTACTTCTATACAACATCCTTCATCCACCCAATTAACTTCTTTTTCCCCATATCCTCCTGATTGCCTCCTC
CTTGTTAAAAATGTCCATCCGGATACCACCAAAACGACCTTACGAACCTTGTTCTCCCAGGCATTTCATTCACTC
GACCAAAAAGGTGTGGATGGATTGGGTTATGTCGACTTCAACAAGGGTATGGACAGATGCTACCTTCGGTTAGCT
GCACCCATGTACGCTAATCTACTCGTGGATCACTTCGACCATCACCTTCGCCAAATTATCCAAGTCTCAGGAATG
GATGAATCTGGTGTTGATATCCGTACAGCGGAAACATCTATACCCAAGGATCTCCAACCGATTTCTGTGGAACGC
GTCATCGGTAGGCCGGAAGAAATTTATTGGGAGAAAGTTCCTGCAAAAGTTAGGAAAACTGCTGTTGAGCATGCG
ATACAGCTTATGACGCTCAGTCGATCTGAAGACCGTGATACGAACCATAGTCATACACGCAAGCATGGAAGGGTG
GGTAGTCAAGATGGTGGTGCACCGAGAACGAATAACTTAGTTAGTATCAACCAAGCTTCGTACCCATACCGTTGC
TGCAGAAGCACTTGA
Gene >AgabiH97|066010
ATGTCCTCGCTCGCCTTCATACCTAGAAAACTCACCAAGTCAGCGCCTGCGAAAGACAAAAAACACACCTCAAAG
CGCGACGAGGACCATTCTTCTTCTAAACCTGTACCAACACTACCAGCGGTCCCTGCTCCAGACGACGTACCAAAC
AAGTATAACGATCAAGACTACGCGAATCTCATTACTTTGTCACTTTCGGACTATGTGTTATGGATCGACCCGGAC
CTTAGAAGAAAGTTCGAAGTTGATTCAGCCGGTGACCAAAGTTGTGAGTATCCTCTGACGTGCCTTTGATCGCCT
GGTACTCAGTATCGGTTGCAGACGTGTCTTTTGACTATCTGTTCGAACACTCTGCCGCGCTTTCAAGCCTTTTGG
AAGTTAAACATGGAAAAGAATCTAGCATAGTGCGAAGCAAAATTCAGGCCGCCTTAGTCAAAGGCATTCGAGCAC
ACGCGAATGATGTTTTCGACGTTCGGCTACTCCTTCACTCGGATGCAGTAGTACCGCGTTTTGGTAAACAAAAGG
ACCTTTCTGGAGGTTATGAAATCAGACGGAAGCGGCTAGGATCACTGTCGAAGGGTAAAGCCGAGTGGGACGCGT
GCACGCTATATCTGGTATGTCATTAGACGCATGGCCCTGATTTTTGAGATGACGGTTTGTTCTAAGGAAAACATA
CCTCCGGGATATCGATCTTATGCTGCCATTATACGGTTTCTGAGCGACTTGTTACATGATGCCCCACCCGTTCCC
TCATCATCGACACTATCTGCCGATCTTCTTGCACGCGTTCAAGGCATATCCTTCCCTGCTCACTATAACGACAAA
CTTGGTGCGCGGCCGACTTGCAAAGGGTTTGCGCTCGTGACATTTGCACATGCAACAGACGTAGAATATCTGCAG
AGTTTCTTCCCGTGGATTGCTAATGAAAATAACGAACGCGGTGGAAAGGGCAAACAAGCTGAGGCGACTGCCGAA
TCCATCCATGCGGCTATACAGTCCAAATTTCGTGTGACAACGAAAAAACATTGGCTCGAGTTGAAGGCCGAATAC
TTGGCGTATAGGCAACGGCTTGTAGAAGAGATTAATGCTCATCAAGATGCGCGGAGAGATGCCCAGACTCATTCA
CAGGAACCCATGGCCGTCTCACCTCCTACGGCGTCTACTTCTATACAACATCCTTCATCCACCCAATTAACTTCT
TTTTCCCCATATCCTCCTGATTGCCTCCTCCTTGTTAAAAATGTCCATCCGGATACCACCAAAACGACCTTACGA
ACCTTGTTCTCCCAGGCATTTCATTCACTCGACCAAAAAGGTGTGGATGGATTGGGTTATGTCGACTTCAACAAG
GGTATGGACAGAGTACGTACAACTTTAGAACTTTCTTTCTCATCCACTCAATAAGTTGTTGCTACAGTGCTACCT
TCGGTTAGCTGCACCCATGTACGCTAATCTACTCGTGGATCACTTCGACCATCACCTTCGCCAAATTATCCAAGT
CTCAGGAATGGATGAATCTGGTGTTGATATCCGTACAGCGGAAACATCTATACCCAAGGATCTCCAACCGATTTC
TGTGGAACGCGTCATCGGTAGGCCGGAAGAAATTTATTGGGAGAAAGTTCCTGCAAAAGTTAGGAAAACTGCTGT
TGAGCATGCGATACAGCTTATGACGCTCAGTCGATCTGAAGACCGTGATACGAACCATAGTCATACACGCAAGCA
TGGAAGGGGTGAGCCAGAGAGGGAGAATGGGCTTTCGCACAAGAAAAGTCGGAATCGGTGAAGTGGGTAGTCAAG
ATGGTGGTGCACCGAGAACGAATAACTTAGGTTCGTACTTTATCCTATGGTTCTACACACCTAACTGCATGACCT
TATTTCGGGTGCATAGTTAGTATCAACCAAGCTTCGTACCCATACCGTTGCTGCAGAAGCACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail