Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|065860
Gene name
Locationscaffold_4:109504..110629
Strand-
Gene length (bp)1125
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 171 193 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 82.39 48.23 116.55
Initials Initials knots 51.55 29.85 73.26
Pileal_Stipeal_center Stage I stipe center 65.86 38.92 92.80
Pileal_Stipeal_shell Stage I stipe shell 49.21 28.27 70.15
DIF_stipe_center Stage II stipe center 56.83 33.20 80.47
DIF_stipe_shell Stage II stipe shell 68.20 40.38 96.03
DIF_stipe_skin Stage II stipe skin 81.98 48.79 115.16
DIF_cap_skin Stage II cap skin 76.43 44.79 108.06
DIF_cap_tissue Stage II cap tissue 65.89 38.51 93.27
DIF_gill_tissue Stage II gill tissue 50.66 29.08 72.24
YFB_stipe_center Young fruiting body stipe center 79.81 47.09 112.53
YFB_stipe_shell Young fruiting body stipe shell 70.57 41.92 99.23
YFB_stipe_skin Young fruiting body stipe skin 86.65 51.57 121.74
YFB_cap_skin Young fruiting body cap skin 58.06 33.96 82.17
YFB_cap_tissue Young fruiting body cap tissue 63.02 37.14 88.89
YFB_gill_tissue Young fruiting body gill tissue 61.02 35.80 86.25
YFB_veil Young fruiting body veil 52.82 30.64 75.00

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.099759 no
Casing YFB_stipe_center 0.953549 no
Casing YFB_stipe_shell 0.710027 no
Casing YFB_stipe_skin 0.925614 no
Casing YFB_cap_skin 0.268874 no
Casing YFB_cap_tissue 0.435715 no
Casing YFB_gill_tissue 0.369453 no
Casing YFB_veil 0.126023 no
Casing Initials 0.098276 no
Casing Pileal_Stipeal_center 0.550526 no
Casing Pileal_Stipeal_shell 0.071968 no
Casing DIF_stipe_center 0.229585 no
Casing DIF_stipe_shell 0.624220 no
Casing DIF_stipe_skin 0.991714 no
Casing DIF_cap_skin 0.882578 no
Casing DIF_cap_tissue 0.552462 no
DIF_gill_tissue YFB_stipe_center 0.117172 no
DIF_gill_tissue YFB_stipe_shell 0.296901 no
DIF_gill_tissue YFB_stipe_skin 0.059513 no
DIF_gill_tissue YFB_cap_skin 0.760356 no
DIF_gill_tissue YFB_cap_tissue 0.560306 no
DIF_gill_tissue YFB_gill_tissue 0.652685 no
DIF_gill_tissue YFB_veil 0.939881 no
YFB_stipe_center YFB_stipe_shell 0.775488 no
YFB_stipe_center YFB_stipe_skin 0.865562 no
YFB_stipe_center YFB_cap_skin 0.321351 no
YFB_stipe_center YFB_cap_tissue 0.499498 no
YFB_stipe_center YFB_gill_tissue 0.434863 no
YFB_stipe_center YFB_veil 0.154113 no
YFB_stipe_shell YFB_stipe_skin 0.580855 no
YFB_stipe_shell YFB_cap_skin 0.613804 no
YFB_stipe_shell YFB_cap_tissue 0.799556 no
YFB_stipe_shell YFB_gill_tissue 0.737305 no
YFB_stipe_shell YFB_veil 0.382372 no
YFB_stipe_skin YFB_cap_skin 0.183562 no
YFB_stipe_skin YFB_cap_tissue 0.313622 no
YFB_stipe_skin YFB_gill_tissue 0.258191 no
YFB_stipe_skin YFB_veil 0.081756 no
YFB_cap_skin YFB_cap_tissue 0.868950 no
YFB_cap_skin YFB_gill_tissue 0.926903 no
YFB_cap_skin YFB_veil 0.845852 no
YFB_cap_tissue YFB_gill_tissue 0.952575 no
YFB_cap_tissue YFB_veil 0.657798 no
YFB_gill_tissue YFB_veil 0.739805 no
Initials DIF_gill_tissue 0.976489 no
Initials YFB_stipe_center 0.124703 no
Initials YFB_stipe_shell 0.324140 no
Initials YFB_stipe_skin 0.061662 no
Initials YFB_cap_skin 0.795629 no
Initials YFB_cap_tissue 0.594019 no
Initials YFB_gill_tissue 0.685225 no
Initials YFB_veil 0.965274 no
Initials Pileal_Stipeal_center 0.492591 no
Initials Pileal_Stipeal_shell 0.933458 no
Initials DIF_stipe_center 0.842540 no
Initials DIF_stipe_shell 0.402283 no
Initials DIF_stipe_skin 0.103796 no
Initials DIF_cap_skin 0.186808 no
Initials DIF_cap_tissue 0.491153 no
Pileal_Stipeal_center DIF_gill_tissue 0.460239 no
Pileal_Stipeal_center YFB_stipe_center 0.611613 no
Pileal_Stipeal_center YFB_stipe_shell 0.887298 no
Pileal_Stipeal_center YFB_stipe_skin 0.413271 no
Pileal_Stipeal_center YFB_cap_skin 0.773688 no
Pileal_Stipeal_center YFB_cap_tissue 0.932054 no
Pileal_Stipeal_center YFB_gill_tissue 0.875284 no
Pileal_Stipeal_center YFB_veil 0.547512 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.393420 no
Pileal_Stipeal_center DIF_stipe_center 0.725231 no
Pileal_Stipeal_center DIF_stipe_shell 0.946845 no
Pileal_Stipeal_center DIF_stipe_skin 0.548713 no
Pileal_Stipeal_center DIF_cap_skin 0.719565 no
Pileal_Stipeal_center DIF_cap_tissue 0.999087 no
Pileal_Stipeal_shell DIF_gill_tissue 0.961688 no
Pileal_Stipeal_shell YFB_stipe_center 0.093175 no
Pileal_Stipeal_shell YFB_stipe_shell 0.252082 no
Pileal_Stipeal_shell YFB_stipe_skin 0.045911 yes
Pileal_Stipeal_shell YFB_cap_skin 0.693786 no
Pileal_Stipeal_shell YFB_cap_tissue 0.492072 no
Pileal_Stipeal_shell YFB_gill_tissue 0.582141 no
Pileal_Stipeal_shell YFB_veil 0.891968 no
Pileal_Stipeal_shell DIF_stipe_center 0.743527 no
Pileal_Stipeal_shell DIF_stipe_shell 0.314436 no
Pileal_Stipeal_shell DIF_stipe_skin 0.077698 no
Pileal_Stipeal_shell DIF_cap_skin 0.146459 no
Pileal_Stipeal_shell DIF_cap_tissue 0.396660 no
DIF_stipe_center DIF_gill_tissue 0.809222 no
DIF_stipe_center YFB_stipe_center 0.278478 no
DIF_stipe_center YFB_stipe_shell 0.557762 no
DIF_stipe_center YFB_stipe_skin 0.148925 no
DIF_stipe_center YFB_cap_skin 0.970845 no
DIF_stipe_center YFB_cap_tissue 0.823446 no
DIF_stipe_center YFB_gill_tissue 0.889676 no
DIF_stipe_center YFB_veil 0.886043 no
DIF_stipe_center DIF_stipe_shell 0.641820 no
DIF_stipe_center DIF_stipe_skin 0.231221 no
DIF_stipe_center DIF_cap_skin 0.369619 no
DIF_stipe_center DIF_cap_tissue 0.729192 no
DIF_stipe_shell DIF_gill_tissue 0.380153 no
DIF_stipe_shell YFB_stipe_center 0.700248 no
DIF_stipe_shell YFB_stipe_shell 0.950611 no
DIF_stipe_shell YFB_stipe_skin 0.499546 no
DIF_stipe_shell YFB_cap_skin 0.698000 no
DIF_stipe_shell YFB_cap_tissue 0.872742 no
DIF_stipe_shell YFB_gill_tissue 0.811140 no
DIF_stipe_shell YFB_veil 0.465573 no
DIF_stipe_shell DIF_stipe_skin 0.640673 no
DIF_stipe_shell DIF_cap_skin 0.803199 no
DIF_stipe_shell DIF_cap_tissue 0.950648 no
DIF_stipe_skin DIF_gill_tissue 0.104271 no
DIF_stipe_skin YFB_stipe_center 0.960621 no
DIF_stipe_skin YFB_stipe_shell 0.718717 no
DIF_stipe_skin YFB_stipe_skin 0.916942 no
DIF_stipe_skin YFB_cap_skin 0.272443 no
DIF_stipe_skin YFB_cap_tissue 0.435575 no
DIF_stipe_skin YFB_gill_tissue 0.370023 no
DIF_stipe_skin YFB_veil 0.126752 no
DIF_stipe_skin DIF_cap_skin 0.889701 no
DIF_stipe_skin DIF_cap_tissue 0.555615 no
DIF_cap_skin DIF_gill_tissue 0.184837 no
DIF_cap_skin YFB_stipe_center 0.936139 no
DIF_cap_skin YFB_stipe_shell 0.870791 no
DIF_cap_skin YFB_stipe_skin 0.776216 no
DIF_cap_skin YFB_cap_skin 0.425977 no
DIF_cap_skin YFB_cap_tissue 0.615356 no
DIF_cap_skin YFB_gill_tissue 0.549789 no
DIF_cap_skin YFB_veil 0.233970 no
DIF_cap_skin DIF_cap_tissue 0.728921 no
DIF_cap_tissue DIF_gill_tissue 0.461263 no
DIF_cap_tissue YFB_stipe_center 0.617413 no
DIF_cap_tissue YFB_stipe_shell 0.891610 no
DIF_cap_tissue YFB_stipe_skin 0.416962 no
DIF_cap_tissue YFB_cap_skin 0.777121 no
DIF_cap_tissue YFB_cap_tissue 0.932744 no
DIF_cap_tissue YFB_gill_tissue 0.877610 no
DIF_cap_tissue YFB_veil 0.551227 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|065860
MLLPLFFVLFQLVSWTQCRQNITLDDNDTKLQYTGGWGQSASTDLDYGGSHALTSNTTAEAVLQFTGVAVYFMSP
LWPYAVSTALTLDSRPTITVDLTDHNTPDTGGGIETVSSSVVWSAENLQNTNHTLRISVGRGELFAIVDGIIYTV
LDPGESETGASGDRHNRVVIIVLATLLGILGLLLLIIIIWLCLRKQNSSGSRTRRRSLTTSEKWGGAAHDDASVA
DPALRGSLQSPPLSPSTAPHTLPPPSRPDSNYNPRETTVWSTSSVGGPGVPNMTGVGASARNSNAFSSHHGDPTH
STSHFAMGSQGDFADPHETRPYLNPNRGTRLPNI*
Coding >AgabiH97|065860
ATGCTTCTCCCTCTCTTCTTCGTGCTCTTTCAACTTGTATCATGGACACAATGCCGACAGAATATCACTCTGGAC
GATAATGATACCAAGCTCCAGTATACAGGTGGATGGGGTCAATCCGCATCAACTGATCTCGACTACGGTGGATCA
CATGCTTTGACGTCGAACACGACGGCAGAGGCAGTATTACAGTTCACTGGTGTTGCCGTATATTTTATGTCGCCC
TTATGGCCGTACGCGGTGTCGACGGCACTTACACTGGATTCTCGTCCAACGATTACCGTCGATCTTACAGATCAT
AATACCCCAGATACGGGAGGGGGTATAGAAACTGTTTCATCCAGTGTCGTGTGGAGTGCAGAAAATCTCCAAAAT
ACGAACCACACCCTCCGGATCTCCGTTGGAAGAGGCGAATTGTTCGCCATAGTTGATGGAATCATATACACTGTT
CTAGATCCCGGTGAATCAGAGACTGGTGCTTCTGGTGATCGCCACAATCGAGTTGTCATCATCGTACTGGCCACA
TTACTGGGCATCCTTGGTCTCCTTCTGCTTATCATCATCATATGGCTATGCCTCCGAAAACAAAACTCATCAGGT
TCGAGGACCAGGAGAAGATCATTAACGACTTCAGAAAAGTGGGGGGGTGCTGCACACGACGATGCTTCAGTCGCC
GACCCAGCACTTCGCGGCTCGCTTCAGAGTCCGCCCTTGAGCCCTTCGACGGCACCGCACACACTCCCGCCACCG
AGTAGGCCTGACAGCAACTATAATCCGCGAGAGACCACCGTATGGTCTACATCATCAGTTGGGGGTCCCGGAGTT
CCAAATATGACTGGTGTGGGCGCCAGTGCGAGGAATTCAAATGCCTTTAGCTCTCACCACGGTGATCCGACGCAC
TCGACGAGCCACTTCGCAATGGGATCTCAAGGAGATTTTGCAGATCCTCACGAGACACGACCTTACTTAAACCCC
AACCGCGGAACAAGGCTTCCCAATATCTGA
Transcript >AgabiH97|065860
ATGCTTCTCCCTCTCTTCTTCGTGCTCTTTCAACTTGTATCATGGACACAATGCCGACAGAATATCACTCTGGAC
GATAATGATACCAAGCTCCAGTATACAGGTGGATGGGGTCAATCCGCATCAACTGATCTCGACTACGGTGGATCA
CATGCTTTGACGTCGAACACGACGGCAGAGGCAGTATTACAGTTCACTGGTGTTGCCGTATATTTTATGTCGCCC
TTATGGCCGTACGCGGTGTCGACGGCACTTACACTGGATTCTCGTCCAACGATTACCGTCGATCTTACAGATCAT
AATACCCCAGATACGGGAGGGGGTATAGAAACTGTTTCATCCAGTGTCGTGTGGAGTGCAGAAAATCTCCAAAAT
ACGAACCACACCCTCCGGATCTCCGTTGGAAGAGGCGAATTGTTCGCCATAGTTGATGGAATCATATACACTGTT
CTAGATCCCGGTGAATCAGAGACTGGTGCTTCTGGTGATCGCCACAATCGAGTTGTCATCATCGTACTGGCCACA
TTACTGGGCATCCTTGGTCTCCTTCTGCTTATCATCATCATATGGCTATGCCTCCGAAAACAAAACTCATCAGGT
TCGAGGACCAGGAGAAGATCATTAACGACTTCAGAAAAGTGGGGGGGTGCTGCACACGACGATGCTTCAGTCGCC
GACCCAGCACTTCGCGGCTCGCTTCAGAGTCCGCCCTTGAGCCCTTCGACGGCACCGCACACACTCCCGCCACCG
AGTAGGCCTGACAGCAACTATAATCCGCGAGAGACCACCGTATGGTCTACATCATCAGTTGGGGGTCCCGGAGTT
CCAAATATGACTGGTGTGGGCGCCAGTGCGAGGAATTCAAATGCCTTTAGCTCTCACCACGGTGATCCGACGCAC
TCGACGAGCCACTTCGCAATGGGATCTCAAGGAGATTTTGCAGATCCTCACGAGACACGACCTTACTTAAACCCC
AACCGCGGAACAAGGCTTCCCAATATCTGA
Gene >AgabiH97|065860
ATGCTTCTCCCTCTCTTCTTCGTGCTCTTTCAACTTGTATCATGGACACAATGCCGACAGAATATCACTCTGGAC
GATAATGATACCAAGCTCCAGTATACAGGTGGATGGGGTCAATCCGCATCAACTGATCTCGACTACGGTGGATCA
CATGCTTTGACGTCGAACACGACGGCAGAGGCAGTATTACAGTTCACTGGTGAATTTCCTTTTGCTTTAAGAATG
AACGATCACAGACTGACATCCACGTAACTCAGGTGTTGCCGTATATTTTATGTCGCCCTTATGGCCGTACGCGGT
GTCGACGGCACTTACACTGGATTCTCGTCCAACGATTACCGTCGATCTTACAGATCATAATACCCCAGATACGGG
AGGGGGTATAGAAACTGTTTCATCCAGTGTCGTGTGGAGTGCAGAAAATCTCCAAAATACGAACCACACCCTCCG
GATCTCCGTTGGAAGAGGCGAATTGTTCGCCATAGTTGATGGAATCATGTACGTTGACATTGCGCCTGTTCTCAT
CACGTTTACTTACGTCTTCCTTTTCCTCCCCGCAGATACACTGTTCTAGATCCCGGTGAATCAGAGACTGGTGCT
TCTGGTGATCGCCACAATCGAGTTGTCATCATCGTACTGGCCACATTACTGGGCATCCTTGGTCTCCTTCTGCTT
ATCATCATCATATGGCTATGCCTCCGAAAACAAAACTCATCAGGTTCGAGGACCAGGAGAAGATCATTAACGACT
TCAGAAAAGTGGGGGGGTGCTGCACACGACGATGCTTCAGTCGCCGACCCAGCACTTCGCGGCTCGCTTCAGAGT
CCGCCCTTGAGCCCTTCGACGGCACCGCACACACTCCCGCCACCGAGTAGGCCTGACAGCAACTATAATCCGCGA
GAGACCACCGTATGGTCTACATCATCAGTTGGGGGTCCCGGAGTTCCAAATATGACTGGTGTGGGCGCCAGTGCG
AGGAATTCAAATGCCTTTAGCTCTCACCACGGTGATCCGACGCACTCGACGAGCCACTTCGCAATGGGATCTCAA
GGAGATTTTGCAGATCCTCACGAGACACGACCTTACTTAAACCCCAACCGCGGAACAAGGCTTCCCAATATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail