Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|065670
Gene name
Locationscaffold_4:48645..50383
Strand-
Gene length (bp)1738
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 1.5E-12 345 378
PF00320 GATA GATA zinc finger 1.8E-11 407 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 322 462 3.0E-22
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 270 462 8.0E-22
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 336 456 1.0E-21
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 313 464 5.0E-21
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 342 456 5.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 322 462 3.0E-22
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 270 462 8.0E-22
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 336 456 1.0E-21
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 313 464 5.0E-21
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 342 456 5.0E-21
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 330 456 8.0E-21
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 270 462 8.0E-21
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 342 456 9.0E-21
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 323 456 9.0E-21
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 335 454 1.0E-20
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 324 456 1.0E-20
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 333 456 1.0E-20
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 333 456 2.0E-20
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 324 456 2.0E-20
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 335 456 3.0E-20
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 345 451 5.0E-20
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 321 456 5.0E-20
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 321 456 6.0E-20
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 321 456 6.0E-20
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 322 456 8.0E-20
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 322 456 9.0E-20
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 336 456 1.0E-19
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 336 456 1.0E-19
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 329 456 2.0E-19
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 343 456 2.0E-19
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 312 465 2.0E-19
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 329 456 2.0E-19
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 336 456 2.0E-19
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 336 456 2.0E-19
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 343 456 1.0E-18
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 343 456 1.0E-18
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 343 456 2.0E-18
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 175 456 2.0E-18
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 304 464 5.0E-18
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 304 464 5.0E-18
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 342 465 7.0E-18
sp|Q95JA5|GATA6_PIG Transcription factor GATA-6 (Fragment) OS=Sus scrofa GN=GATA6 PE=2 SV=2 343 460 4.0E-17
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 343 464 4.0E-16
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 342 456 1.0E-14
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 342 456 1.0E-14
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 342 456 4.0E-14
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 404 456 5.0E-11
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 395 461 1.0E-10
sp|Q10280|GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gaf1 PE=1 SV=2 360 463 3.0E-10
sp|P42944|GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GZF3 PE=1 SV=1 403 461 9.0E-10
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 404 456 1.0E-09
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 403 461 1.0E-09
sp|P18494|GLN3_YEAST Nitrogen regulatory protein GLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN3 PE=1 SV=2 406 454 2.0E-09
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 399 456 2.0E-09
sp|Q01582|AREA_PENCH Nitrogen regulatory protein areA OS=Penicillium chrysogenum GN=AREA PE=3 SV=1 405 456 3.0E-09
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 395 461 3.0E-09
sp|P43574|GAT1_YEAST Transcriptional regulatory protein GAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT1 PE=1 SV=1 321 444 4.0E-09
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 395 461 5.0E-09
sp|Q5A432|GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAT1 PE=2 SV=1 404 456 9.0E-09
sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-2 PE=1 SV=2 407 461 9.0E-09
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 393 456 1.0E-08
sp|Q01168|NUT1_MAGO7 Nitrogen regulatory protein NUT1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NUT1 PE=3 SV=1 407 460 1.0E-08
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 407 456 1.0E-08
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 407 461 1.0E-08
sp|P43574|GAT1_YEAST Transcriptional regulatory protein GAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT1 PE=1 SV=1 406 456 2.0E-08
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL80 PE=2 SV=1 405 452 2.0E-08
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 394 464 4.0E-08
sp|Q10134|FEP1_SCHPO Iron-sensing transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fep1 PE=1 SV=1 407 456 8.0E-08
sp|Q92259|SREP_PENCH GATA factor SREP OS=Penicillium chrysogenum GN=SREP PE=3 SV=1 395 450 2.0E-07
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 305 385 3.0E-07
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 305 385 4.0E-07
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 403 448 9.0E-07
sp|Q5A432|GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAT1 PE=2 SV=1 338 385 2.0E-06
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 307 385 3.0E-06
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 307 385 4.0E-06
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 403 449 4.0E-06
sp|Q92259|SREP_PENCH GATA factor SREP OS=Penicillium chrysogenum GN=SREP PE=3 SV=1 407 456 5.0E-06
sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditis elegans GN=elt-2 PE=2 SV=1 404 462 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0003677 DNA binding No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4066 0.8536 0.0313 0.0485 0.1985 0.0053 0.1917 0.0691 0.0399 0.0077

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup2579
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|065670
Agaricus bisporus var bisporus H97 AgabiH97|065670 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|065670
MAPARFGWSVGLLEGVGFKALLMLARNSNQVFSPLVAAVRISHSSLPTCANKRIGRYPRLVISCSLFGSSDPVLH
RISTPLTPAYNPSANLMCGLNNRQHQMHTSSPVASYTSSIPPHQLDHPSMDLASSWQDNSGHARYGTSATNGYVN
NVPKNMSQSNAFASNSHAANSRNHYYASSERSTVHSFEQQEWSPSISPQSVHPSALPPTTASSTIYPDNTYRHIT
HHSTPEWNQWSEHHSDMSNLRVGTGTTAMSHWQNGDLRVSSFGPQSLDDLLYTNATNSPAYSVATDLPPIQSTRG
YQISPISSPSPSPSASSRHISPQSSVSPPSSRRGSVDASAGGKKCSHCNATSTPLWRREPTTLKPLCNACGLYLQ
QRHRHRPRELIDADQEDEESEEEDQNYNGPECSHCHTHRTSVWRRSKTGAQLCNACGVYARLRGKDRPLTLKRKK
IKPRTKHASSSGVKSP*
Coding >AgabiH97|065670
ATGGCTCCCGCTCGGTTTGGTTGGTCAGTTGGACTGCTGGAAGGAGTTGGTTTCAAGGCCCTTTTGATGCTTGCG
CGCAACTCAAACCAAGTCTTTTCCCCGTTGGTTGCGGCGGTGCGAATTTCGCACTCGAGTCTCCCTACTTGTGCA
AATAAGCGAATTGGTCGGTATCCTCGTCTGGTCATCAGTTGCTCTTTGTTTGGATCTTCAGATCCCGTACTGCAT
AGGATTTCCACACCCTTGACTCCAGCTTATAATCCGTCAGCTAATCTTATGTGTGGCCTGAATAATAGGCAACAT
CAAATGCACACTTCTAGTCCAGTGGCGTCCTACACTTCGTCGATTCCACCCCACCAACTTGACCATCCAAGCATG
GACCTCGCGAGTTCCTGGCAAGATAACTCTGGTCACGCCCGGTATGGTACAAGCGCCACCAACGGTTACGTGAAC
AATGTACCCAAGAATATGAGCCAGTCGAATGCATTCGCATCGAACTCTCATGCAGCTAACAGCCGAAACCATTAC
TATGCTTCGTCCGAAAGAAGCACTGTACACTCTTTCGAACAGCAAGAATGGTCGCCGTCTATCTCTCCTCAATCC
GTTCACCCCTCAGCGCTTCCTCCCACCACAGCTTCCAGTACAATATACCCTGACAATACTTATCGACACATAACG
CATCACTCTACACCGGAGTGGAACCAGTGGTCTGAGCATCACTCGGACATGTCCAATCTCAGAGTTGGCACTGGC
ACTACTGCGATGTCACATTGGCAGAATGGTGATTTACGCGTTTCATCTTTCGGACCCCAGTCCCTCGACGACTTA
CTCTACACTAATGCCACCAATTCGCCCGCTTACTCCGTCGCAACTGATCTTCCTCCGATCCAATCAACCCGAGGT
TATCAGATATCCCCCATTTCGTCTCCCTCACCTTCCCCATCCGCGTCCTCTCGCCACATCTCACCACAGTCCAGC
GTATCACCTCCTTCATCTCGTCGGGGCAGCGTCGATGCTTCAGCCGGGGGAAAAAAATGCTCTCATTGTAATGCG
ACCTCGACCCCGTTGTGGCGTCGAGAACCTACGACTCTTAAACCCCTATGTAACGCTTGTGGACTTTATCTACAA
CAGCGTCATAGACACCGACCCAGAGAACTTATCGACGCCGACCAAGAAGACGAAGAAAGCGAAGAAGAAGATCAA
AATTACAACGGGCCCGAGTGTAGCCATTGTCATACACATCGAACTTCGGTTTGGCGACGGAGCAAAACGGGGGCT
CAGCTTTGTAACGCTTGTGGTGTATACGCGAGGCTACGCGGCAAGGACCGACCGCTCACTTTGAAACGCAAGAAG
ATTAAACCCCGTACCAAGCACGCGTCGTCTTCTGGGGTTAAGTCTCCCTAG
Transcript >AgabiH97|065670
ATGGCTCCCGCTCGGTTTGGTTGGTCAGTTGGACTGCTGGAAGGAGTTGGTTTCAAGGCCCTTTTGATGCTTGCG
CGCAACTCAAACCAAGTCTTTTCCCCGTTGGTTGCGGCGGTGCGAATTTCGCACTCGAGTCTCCCTACTTGTGCA
AATAAGCGAATTGGTCGGTATCCTCGTCTGGTCATCAGTTGCTCTTTGTTTGGATCTTCAGATCCCGTACTGCAT
AGGATTTCCACACCCTTGACTCCAGCTTATAATCCGTCAGCTAATCTTATGTGTGGCCTGAATAATAGGCAACAT
CAAATGCACACTTCTAGTCCAGTGGCGTCCTACACTTCGTCGATTCCACCCCACCAACTTGACCATCCAAGCATG
GACCTCGCGAGTTCCTGGCAAGATAACTCTGGTCACGCCCGGTATGGTACAAGCGCCACCAACGGTTACGTGAAC
AATGTACCCAAGAATATGAGCCAGTCGAATGCATTCGCATCGAACTCTCATGCAGCTAACAGCCGAAACCATTAC
TATGCTTCGTCCGAAAGAAGCACTGTACACTCTTTCGAACAGCAAGAATGGTCGCCGTCTATCTCTCCTCAATCC
GTTCACCCCTCAGCGCTTCCTCCCACCACAGCTTCCAGTACAATATACCCTGACAATACTTATCGACACATAACG
CATCACTCTACACCGGAGTGGAACCAGTGGTCTGAGCATCACTCGGACATGTCCAATCTCAGAGTTGGCACTGGC
ACTACTGCGATGTCACATTGGCAGAATGGTGATTTACGCGTTTCATCTTTCGGACCCCAGTCCCTCGACGACTTA
CTCTACACTAATGCCACCAATTCGCCCGCTTACTCCGTCGCAACTGATCTTCCTCCGATCCAATCAACCCGAGGT
TATCAGATATCCCCCATTTCGTCTCCCTCACCTTCCCCATCCGCGTCCTCTCGCCACATCTCACCACAGTCCAGC
GTATCACCTCCTTCATCTCGTCGGGGCAGCGTCGATGCTTCAGCCGGGGGAAAAAAATGCTCTCATTGTAATGCG
ACCTCGACCCCGTTGTGGCGTCGAGAACCTACGACTCTTAAACCCCTATGTAACGCTTGTGGACTTTATCTACAA
CAGCGTCATAGACACCGACCCAGAGAACTTATCGACGCCGACCAAGAAGACGAAGAAAGCGAAGAAGAAGATCAA
AATTACAACGGGCCCGAGTGTAGCCATTGTCATACACATCGAACTTCGGTTTGGCGACGGAGCAAAACGGGGGCT
CAGCTTTGTAACGCTTGTGGTGTATACGCGAGGCTACGCGGCAAGGACCGACCGCTCACTTTGAAACGCAAGAAG
ATTAAACCCCGTACCAAGCACGCGTCGTCTTCTGGGGTTAAGTCTCCCTAG
Gene >AgabiH97|065670
ATGGCTCCCGCTCGGGTCTGCTGTGGTGCCCAGGCTTGAATGACACGATTAGCTTTAGCTTACCCAGAGCAGCAT
GGGCTAAAGGACCTACACTTCAATTTTCGAACTTATTTTGCACCCAGTTTGGTTGGTCAGTTGGACTGCTGGAAG
GAGTTGGTTTCAAGGTGAGTAGACTCCGTTCAAGTCGGTTTACGTCAGTATCTACTTAGAGTCCATCAATCTTGG
ATCTTGAACCGGCCGGAATGCCTATCCCCAATCAGTTATTTATTGACAGATAGGCCCTTTTGATGCTTGCGCGCA
ACTCAAACCAAGTCTTTTCCCCGTTGGTTGCGGCGGTGCGAATTTCGCACTCGAGTCTCCCTACTTGTGCAAATA
AGCGAATTGGTCGGTATCCTCGTCTGGTCATCAGTTGCTCTTTGTTTGGATCTTCAGATCCCGTACTGCATAGGA
TTTCCACACCCTTGACTCCAGGTACTGTATAAAAGCACCCCTCTTCCTCCTTCACGATCTCATTCACCGCAACAA
TGCTAGCAGCTTATAATCCGTCAGCTAATCTTATGTGTGGCCTGAATAATAGGCAACATCAAATGCACACTTCTA
GTCCAGTGGCGTCCTACACTTCGTCGATTCCACCCCACCAACTTGACCATCCAAGCATGGACCTCGCGAGTTCCT
GGCAAGGTACATACCAAAAGTTTCGATAATCTCACTCATGTGTTGACAACTCATCATAGATAACTCTGGTCACGC
CCGGTATGGTACAAGCGCCACCAACGGTTACGTGAACAATGTACCCAAGAATATGAGCCAGTCGAATGCATTCGC
ATCGAACTCTCATGCAGCTAACAGCCGAAACCATTACTATGCTTCGTCCGAAAGAAGCACTGTACACTCTTTCGA
ACAGCAAGAATGGTCGCCGTCTATCTCTCCTCAATCCGTTCACCCCTCAGCGCTTCCTCCCACCACAGCTTCCAG
TACAATATACCCTGACAATACTTATCGACACATAACGCATCACTCTACACCGGAGTGGAACCAGTGGTCTGAGCA
TCACTCGGACATGTCCAATCTCAGAGTTGGCACTGGCACTACTGCGATGTCACATTGGCAGAATGGTGATTTACG
CGTTTCATCTTTCGGACCCCAGTCCCTCGACGACTTACTCTACACTAATGCCACCAATTCGCCCGCTTACTCCGT
CGCAACTGATCTTCCTCCGATCCAATCAACCCGAGGTTATCAGATATCCCCCATTTCGTCTCCCTCACCTTCCCC
ATCCGCGTCCTCTCGCCACATCTCACCACAGTCCAGCGTATCACCTCCTTCATCTCGTCGGGGCAGCGTCGATGC
TTCAGCCGGGGGAAAAAAATGCTCTCATTGTAATGCGACCTCGACCCCGTTGTGGCGTCGAGAACCTACGACTCT
TAAACCCCTATGTAACGCTTGTGGACTTTATCTACAACAGCGTCATAGACACCGACCCAGAGAACTTATCGACGC
CGACCAAGAAGACGAAGAAAGCGAAGAAGAAGATCAAAATTACAACGGGCCCGAGTGTAGCCATTGTCATACACA
TCGAACTTCGGTTTGGCGACGGAGCAAAACGGGGGCTCAGCTTTGTAACGCTTGTGGTGTATACGCGAGGCTACG
CGGCAAGGACCGACCGCTCACTTTGAAACGCAAGAAGATTAAACCCCGTACCAAGCACGCGTCGTCTTCTGGGGT
TAAGTCTCCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail