Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|065630
Gene name
Locationscaffold_4:35871..38612
Strand+
Gene length (bp)2741
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 1.3E-37 162 555
PF07687 M20_dimer Peptidase dimerisation domain 1.1E-07 282 439

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.08 PE=3 SV=1 78 564 8.0E-97
sp|P27614|CBPS_YEAST Carboxypeptidase S OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPS1 PE=1 SV=2 31 560 1.0E-95
sp|P0C155|CBPS2_YEAST Putative carboxypeptidase YOL153C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL153C PE=5 SV=1 64 560 7.0E-85
sp|Q55FR8|CBPS2_DICDI Probable carboxypeptidase S-like 2 OS=Dictyostelium discoideum GN=DDB_G0267984 PE=3 SV=1 90 555 3.0E-67
sp|Q08BT9|P20D1_XENTR Probable carboxypeptidase PM20D1 OS=Xenopus tropicalis GN=pm20d1 PE=2 SV=1 86 555 9.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.08 PE=3 SV=1 78 564 8.0E-97
sp|P27614|CBPS_YEAST Carboxypeptidase S OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPS1 PE=1 SV=2 31 560 1.0E-95
sp|P0C155|CBPS2_YEAST Putative carboxypeptidase YOL153C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL153C PE=5 SV=1 64 560 7.0E-85
sp|Q55FR8|CBPS2_DICDI Probable carboxypeptidase S-like 2 OS=Dictyostelium discoideum GN=DDB_G0267984 PE=3 SV=1 90 555 3.0E-67
sp|Q08BT9|P20D1_XENTR Probable carboxypeptidase PM20D1 OS=Xenopus tropicalis GN=pm20d1 PE=2 SV=1 86 555 9.0E-67
sp|Q8C165|P20D1_MOUSE Probable carboxypeptidase PM20D1 OS=Mus musculus GN=Pm20d1 PE=1 SV=1 86 555 1.0E-65
sp|Q2T9M7|P20D1_BOVIN Probable carboxypeptidase PM20D1 OS=Bos taurus GN=PM20D1 PE=2 SV=1 86 555 1.0E-64
sp|Q5ZL18|P20D1_CHICK Probable carboxypeptidase PM20D1 OS=Gallus gallus GN=PM20D1 PE=2 SV=1 73 555 2.0E-62
sp|Q32LT9|P2011_DANRE Probable carboxypeptidase PM20D1.1 OS=Danio rerio GN=pm20d1.1 PE=2 SV=1 80 555 4.0E-62
sp|Q08BB2|P2012_DANRE Probable carboxypeptidase PM20D1.2 OS=Danio rerio GN=pm20d1.2 PE=2 SV=1 93 555 4.0E-62
sp|Q6GTS8|P20D1_HUMAN Probable carboxypeptidase PM20D1 OS=Homo sapiens GN=PM20D1 PE=2 SV=3 86 555 8.0E-59
sp|Q55DL1|CBPS1_DICDI Probable carboxypeptidase S-like 1 OS=Dictyostelium discoideum GN=DDB_G0270582 PE=3 SV=1 86 556 3.0E-52
sp|A1SXF9|DAPE_PSYIN Succinyl-diaminopimelate desuccinylase OS=Psychromonas ingrahamii (strain 37) GN=dapE PE=3 SV=1 159 541 4.0E-12
sp|P37111|ACY1_PIG Aminoacylase-1 OS=Sus scrofa GN=ACY1 PE=1 SV=2 140 241 3.0E-11
sp|A9ILD7|DAPE_BART1 Succinyl-diaminopimelate desuccinylase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dapE PE=3 SV=1 161 304 7.0E-11
sp|Q6G1H9|DAPE_BARQU Succinyl-diaminopimelate desuccinylase OS=Bartonella quintana (strain Toulouse) GN=dapE PE=3 SV=1 161 304 8.0E-11
sp|Q6GF48|DAPE_STAAR Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MRSA252) GN=dapE PE=3 SV=1 163 553 8.0E-11
sp|Q0A7H5|DAPE_ALKEH Succinyl-diaminopimelate desuccinylase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dapE PE=3 SV=1 161 318 1.0E-10
sp|B0BTF3|DAPE_ACTPJ Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dapE PE=3 SV=1 153 318 1.0E-10
sp|A1K719|DAPE_AZOSB Succinyl-diaminopimelate desuccinylase OS=Azoarcus sp. (strain BH72) GN=dapE PE=3 SV=1 142 264 3.0E-10
sp|Q7VRT2|DAPE_BLOFL Succinyl-diaminopimelate desuccinylase OS=Blochmannia floridanus GN=dapE PE=3 SV=1 161 322 4.0E-10
sp|A1UUD2|DAPE_BARBK Succinyl-diaminopimelate desuccinylase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dapE PE=3 SV=1 161 304 4.0E-10
sp|Q03154|ACY1_HUMAN Aminoacylase-1 OS=Homo sapiens GN=ACY1 PE=1 SV=1 140 241 5.0E-10
sp|Q5RFB0|ACY1_PONAB Aminoacylase-1 OS=Pongo abelii GN=ACY1 PE=2 SV=2 140 241 5.0E-10
sp|Q99JW2|ACY1_MOUSE Aminoacylase-1 OS=Mus musculus GN=Acy1 PE=1 SV=1 140 241 5.0E-10
sp|Q6AYS7|ACY1A_RAT Aminoacylase-1A OS=Rattus norvegicus GN=Acy1a PE=1 SV=1 140 241 6.0E-10
sp|Q6PTT0|ACY1B_RAT Aminoacylase-1B OS=Rattus norvegicus GN=Acy1b PE=1 SV=1 140 241 7.0E-10
sp|Q6G567|DAPE_BARHE Succinyl-diaminopimelate desuccinylase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dapE PE=3 SV=1 161 328 2.0E-09
sp|Q55DP8|ACY1_DICDI Aminoacylase-1 OS=Dictyostelium discoideum GN=acy1 PE=2 SV=1 147 265 2.0E-09
sp|Q8CQC2|DAPE_STAES Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dapE PE=3 SV=1 165 554 2.0E-09
sp|Q931I4|DAPE_STAAM Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dapE PE=3 SV=1 163 414 2.0E-09
sp|Q5HKI1|DAPE_STAEQ Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dapE PE=3 SV=1 165 554 3.0E-09
sp|Q8NVL7|DAPE_STAAW Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MW2) GN=dapE PE=3 SV=1 163 414 3.0E-09
sp|Q6G7T6|DAPE_STAAS Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MSSA476) GN=dapE PE=3 SV=1 163 414 3.0E-09
sp|Q99SN6|DAPE_STAAN Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain N315) GN=dapE PE=1 SV=1 163 414 4.0E-09
sp|Q28VJ1|DAPE_JANSC Succinyl-diaminopimelate desuccinylase OS=Jannaschia sp. (strain CCS1) GN=dapE PE=3 SV=1 137 235 4.0E-09
sp|Q6FE14|DAPE_ACIAD Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dapE PE=3 SV=1 161 304 6.0E-09
sp|B8F824|DAPE_HAEPS Succinyl-diaminopimelate desuccinylase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dapE PE=3 SV=1 165 318 6.0E-09
sp|Q9CM22|DAPE_PASMU Succinyl-diaminopimelate desuccinylase OS=Pasteurella multocida (strain Pm70) GN=dapE PE=3 SV=1 153 318 6.0E-09
sp|A6VMI0|DAPE_ACTSZ Succinyl-diaminopimelate desuccinylase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dapE PE=3 SV=1 165 261 7.0E-09
sp|B9JZL9|DAPE_AGRVS Succinyl-diaminopimelate desuccinylase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dapE PE=3 SV=1 161 235 7.0E-09
sp|Q5NYT7|DAPE_AROAE Succinyl-diaminopimelate desuccinylase OS=Aromatoleum aromaticum (strain EbN1) GN=dapE PE=3 SV=1 160 542 9.0E-09
sp|B4RZS0|DAPE1_ALTMD Succinyl-diaminopimelate desuccinylase 1 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=dapE1 PE=3 SV=3 161 323 1.0E-08
sp|Q47FB0|DAPE_DECAR Succinyl-diaminopimelate desuccinylase OS=Dechloromonas aromatica (strain RCB) GN=dapE PE=3 SV=1 144 304 1.0E-08
sp|Q1LNH3|DAPE_CUPMC Succinyl-diaminopimelate desuccinylase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dapE PE=3 SV=1 152 338 1.0E-08
sp|Q7N3J4|DAPE_PHOLL Succinyl-diaminopimelate desuccinylase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dapE PE=3 SV=1 165 321 1.0E-08
sp|B3H2U3|DAPE_ACTP7 Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=dapE PE=3 SV=1 162 318 2.0E-08
sp|A3N3G9|DAPE_ACTP2 Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dapE PE=3 SV=1 162 318 2.0E-08
sp|Q65US9|DAPE_MANSM Succinyl-diaminopimelate desuccinylase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dapE PE=3 SV=1 153 261 2.0E-08
sp|Q8D2S2|DAPE_WIGBR Succinyl-diaminopimelate desuccinylase OS=Wigglesworthia glossinidia brevipalpis GN=dapE PE=3 SV=1 161 268 2.0E-08
sp|A0RNM0|DAPE_CAMFF Succinyl-diaminopimelate desuccinylase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=dapE PE=3 SV=1 165 325 2.0E-08
sp|Q7VNB3|DAPE_HAEDU Succinyl-diaminopimelate desuccinylase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dapE PE=3 SV=1 161 318 2.0E-08
sp|B5ZN23|DAPE_RHILW Succinyl-diaminopimelate desuccinylase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dapE PE=3 SV=1 161 304 3.0E-08
sp|A4WD51|DAPE_ENT38 Succinyl-diaminopimelate desuccinylase OS=Enterobacter sp. (strain 638) GN=dapE PE=3 SV=1 165 304 4.0E-08
sp|B5F0L0|DAPE_SALA4 Succinyl-diaminopimelate desuccinylase OS=Salmonella agona (strain SL483) GN=dapE PE=3 SV=1 165 304 4.0E-08
sp|A1U3R0|DAPE_MARHV Succinyl-diaminopimelate desuccinylase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dapE PE=3 SV=1 161 441 5.0E-08
sp|B0UT10|DAPE_HISS2 Succinyl-diaminopimelate desuccinylase OS=Histophilus somni (strain 2336) GN=dapE PE=3 SV=1 159 261 5.0E-08
sp|Q0VQG3|DAPE_ALCBS Succinyl-diaminopimelate desuccinylase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dapE PE=3 SV=1 161 304 5.0E-08
sp|Q6VE94|DAPE_PSESY Succinyl-diaminopimelate desuccinylase OS=Pseudomonas syringae pv. syringae GN=dapE PE=3 SV=1 160 304 6.0E-08
sp|B6IPH8|DAPE_RHOCS Succinyl-diaminopimelate desuccinylase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dapE PE=3 SV=1 161 331 6.0E-08
sp|B5XVN4|DAPE_KLEP3 Succinyl-diaminopimelate desuccinylase OS=Klebsiella pneumoniae (strain 342) GN=dapE PE=3 SV=1 165 304 7.0E-08
sp|Q11LD2|DAPE_CHESB Succinyl-diaminopimelate desuccinylase OS=Chelativorans sp. (strain BNC1) GN=dapE PE=3 SV=1 161 555 7.0E-08
sp|B6I539|DAPE_ECOSE Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain SE11) GN=dapE PE=3 SV=1 165 304 7.0E-08
sp|A6TC94|DAPE_KLEP7 Succinyl-diaminopimelate desuccinylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dapE PE=3 SV=1 165 304 8.0E-08
sp|Q0HJ36|DAPE_SHESM Succinyl-diaminopimelate desuccinylase OS=Shewanella sp. (strain MR-4) GN=dapE PE=3 SV=1 161 304 8.0E-08
sp|Q0HUU6|DAPE_SHESR Succinyl-diaminopimelate desuccinylase OS=Shewanella sp. (strain MR-7) GN=dapE PE=3 SV=1 161 304 9.0E-08
sp|Q3IL20|DAPE_PSEHT Succinyl-diaminopimelate desuccinylase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dapE PE=3 SV=1 161 304 9.0E-08
sp|Q98D57|DAPE_RHILO Succinyl-diaminopimelate desuccinylase OS=Rhizobium loti (strain MAFF303099) GN=dapE PE=3 SV=1 161 304 1.0E-07
sp|Q8ZN75|DAPE_SALTY Succinyl-diaminopimelate desuccinylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dapE PE=1 SV=1 165 304 1.0E-07
sp|B4TR55|DAPE_SALSV Succinyl-diaminopimelate desuccinylase OS=Salmonella schwarzengrund (strain CVM19633) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|A9N2Z9|DAPE_SALPB Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|B4T0L0|DAPE_SALNS Succinyl-diaminopimelate desuccinylase OS=Salmonella newport (strain SL254) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|B4TD58|DAPE_SALHS Succinyl-diaminopimelate desuccinylase OS=Salmonella heidelberg (strain SL476) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|B5RCV3|DAPE_SALG2 Succinyl-diaminopimelate desuccinylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|B5R4J0|DAPE_SALEP Succinyl-diaminopimelate desuccinylase OS=Salmonella enteritidis PT4 (strain P125109) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|B5FQH3|DAPE_SALDC Succinyl-diaminopimelate desuccinylase OS=Salmonella dublin (strain CT_02021853) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|A9MHQ8|DAPE_SALAR Succinyl-diaminopimelate desuccinylase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|B5BB22|DAPE_SALPK Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi A (strain AKU_12601) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|C0PYS5|DAPE_SALPC Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi C (strain RKS4594) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|Q5PLR5|DAPE_SALPA Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|Q57LM8|DAPE_SALCH Succinyl-diaminopimelate desuccinylase OS=Salmonella choleraesuis (strain SC-B67) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|B0KS83|DAPE_PSEPG Succinyl-diaminopimelate desuccinylase OS=Pseudomonas putida (strain GB-1) GN=dapE PE=3 SV=1 155 304 1.0E-07
sp|Q8Z4S2|DAPE_SALTI Succinyl-diaminopimelate desuccinylase OS=Salmonella typhi GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|Q0TF05|DAPE_ECOL5 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|B2TXP7|DAPE_SHIB3 Succinyl-diaminopimelate desuccinylase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|Q32D98|DAPE_SHIDS Succinyl-diaminopimelate desuccinylase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|Q1R8Q6|DAPE_ECOUT Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain UTI89 / UPEC) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|Q8FF82|DAPE_ECOL6 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|A1ADX7|DAPE_ECOK1 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O1:K1 / APEC GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|B7MHW4|DAPE_ECO45 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dapE PE=3 SV=1 165 304 1.0E-07
sp|Q3YZ81|DAPE_SHISS Succinyl-diaminopimelate desuccinylase OS=Shigella sonnei (strain Ss046) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|Q0T246|DAPE_SHIF8 Succinyl-diaminopimelate desuccinylase OS=Shigella flexneri serotype 5b (strain 8401) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|P0AED8|DAPE_SHIFL Succinyl-diaminopimelate desuccinylase OS=Shigella flexneri GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|Q31Y20|DAPE_SHIBS Succinyl-diaminopimelate desuccinylase OS=Shigella boydii serotype 4 (strain Sb227) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|B1LNC1|DAPE_ECOSM Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|P0AED7|DAPE_ECOLI Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain K12) GN=dapE PE=1 SV=1 165 304 2.0E-07
sp|B1IWI8|DAPE_ECOLC Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|A8A2W3|DAPE_ECOHS Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O9:H4 (strain HS) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|B1XAE3|DAPE_ECODH Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain K12 / DH10B) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|C4ZX46|DAPE_ECOBW Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|B7M7H2|DAPE_ECO8A Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O8 (strain IAI1) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|B7LCK7|DAPE_ECO55 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain 55989 / EAEC) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|B7UGM1|DAPE_ECO27 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|A7ZPR5|DAPE_ECO24 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|B7NQK9|DAPE_ECO7I Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|B7N653|DAPE_ECOLU Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|Q88MP5|DAPE_PSEPK Succinyl-diaminopimelate desuccinylase OS=Pseudomonas putida (strain KT2440) GN=dapE PE=3 SV=1 155 304 2.0E-07
sp|A5W863|DAPE_PSEP1 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dapE PE=3 SV=1 155 304 2.0E-07
sp|Q5FPX5|DAPE_GLUOX Succinyl-diaminopimelate desuccinylase OS=Gluconobacter oxydans (strain 621H) GN=dapE PE=3 SV=2 161 304 2.0E-07
sp|Q02IY2|DAPE_PSEAB Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dapE PE=3 SV=1 160 304 2.0E-07
sp|Q2W0E7|DAPE_MAGSA Succinyl-diaminopimelate desuccinylase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dapE PE=3 SV=1 135 304 2.0E-07
sp|C5CLT2|DAPE_VARPS Succinyl-diaminopimelate desuccinylase OS=Variovorax paradoxus (strain S110) GN=dapE PE=3 SV=1 159 304 2.0E-07
sp|B1JBS2|DAPE_PSEPW Succinyl-diaminopimelate desuccinylase OS=Pseudomonas putida (strain W619) GN=dapE PE=3 SV=1 160 304 2.0E-07
sp|Q1QDC1|DAPE_PSYCK Succinyl-diaminopimelate desuccinylase OS=Psychrobacter cryohalolentis (strain K5) GN=dapE PE=3 SV=1 136 304 2.0E-07
sp|A5UB44|DAPE_HAEIE Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain PittEE) GN=dapE PE=3 SV=1 163 261 2.0E-07
sp|B7LKH0|DAPE_ESCF3 Succinyl-diaminopimelate desuccinylase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dapE PE=3 SV=1 165 304 2.0E-07
sp|Q87MI6|DAPE_VIBPA Succinyl-diaminopimelate desuccinylase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dapE PE=3 SV=1 161 304 2.0E-07
sp|Q4QP83|DAPE_HAEI8 Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain 86-028NP) GN=dapE PE=3 SV=1 165 261 3.0E-07
sp|A0KWH4|DAPE_SHESA Succinyl-diaminopimelate desuccinylase OS=Shewanella sp. (strain ANA-3) GN=dapE PE=3 SV=1 161 304 3.0E-07
sp|Q0ASJ5|DAPE_MARMM Succinyl-diaminopimelate desuccinylase OS=Maricaulis maris (strain MCS10) GN=dapE PE=3 SV=1 148 304 3.0E-07
sp|B0TVI4|DAPE_SHEHH Succinyl-diaminopimelate desuccinylase OS=Shewanella halifaxensis (strain HAW-EB4) GN=dapE PE=3 SV=1 161 327 3.0E-07
sp|B4EY70|DAPE_PROMH Succinyl-diaminopimelate desuccinylase OS=Proteus mirabilis (strain HI4320) GN=dapE PE=3 SV=1 165 304 3.0E-07
sp|Q1I614|DAPE_PSEE4 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas entomophila (strain L48) GN=dapE PE=3 SV=1 160 304 3.0E-07
sp|Q8EEB6|DAPE_SHEON Succinyl-diaminopimelate desuccinylase OS=Shewanella oneidensis (strain MR-1) GN=dapE PE=3 SV=1 161 304 3.0E-07
sp|Q4FNF5|DAPE_PELUB Succinyl-diaminopimelate desuccinylase OS=Pelagibacter ubique (strain HTCC1062) GN=dapE PE=3 SV=1 161 316 3.0E-07
sp|B2VE50|DAPE_ERWT9 Succinyl-diaminopimelate desuccinylase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dapE PE=3 SV=1 165 304 3.0E-07
sp|Q13F22|DAPE_RHOPS Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain BisB5) GN=dapE PE=3 SV=1 144 235 3.0E-07
sp|A9HKR2|DAPE_GLUDA Succinyl-diaminopimelate desuccinylase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dapE PE=3 SV=1 161 328 3.0E-07
sp|P44514|DAPE_HAEIN Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dapE PE=1 SV=1 165 261 3.0E-07
sp|A7ML10|DAPE_CROS8 Succinyl-diaminopimelate desuccinylase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dapE PE=3 SV=1 165 304 3.0E-07
sp|A8ADB6|DAPE_CITK8 Succinyl-diaminopimelate desuccinylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=dapE PE=3 SV=1 165 304 4.0E-07
sp|Q7NY19|DAPE_CHRVO Succinyl-diaminopimelate desuccinylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dapE PE=3 SV=1 161 264 4.0E-07
sp|A0KIB5|DAPE_AERHH Succinyl-diaminopimelate desuccinylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dapE PE=3 SV=1 161 304 4.0E-07
sp|Q1MM75|DAPE_RHIL3 Succinyl-diaminopimelate desuccinylase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dapE PE=3 SV=1 161 304 5.0E-07
sp|Q608D9|DAPE_METCA Succinyl-diaminopimelate desuccinylase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dapE PE=3 SV=1 161 304 5.0E-07
sp|Q6LTW8|DAPE_PHOPR Succinyl-diaminopimelate desuccinylase OS=Photobacterium profundum GN=dapE PE=3 SV=1 161 235 5.0E-07
sp|A6U5J1|DAPE_SINMW Succinyl-diaminopimelate desuccinylase OS=Sinorhizobium medicae (strain WSM419) GN=dapE PE=3 SV=2 161 304 5.0E-07
sp|Q8DBA6|DAPE_VIBVU Succinyl-diaminopimelate desuccinylase OS=Vibrio vulnificus (strain CMCP6) GN=dapE PE=3 SV=1 161 304 5.0E-07
sp|A8H424|DAPE_SHEPA Succinyl-diaminopimelate desuccinylase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dapE PE=3 SV=1 161 327 5.0E-07
sp|Q9I4H5|DAPE_PSEAE Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dapE PE=3 SV=1 160 304 5.0E-07
sp|B7UX27|DAPE_PSEA8 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain LESB58) GN=dapE PE=3 SV=1 160 304 5.0E-07
sp|B5Z008|DAPE_ECO5E Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dapE PE=3 SV=1 165 304 5.0E-07
sp|Q8XBE0|DAPE_ECO57 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O157:H7 GN=dapE PE=3 SV=1 165 304 5.0E-07
sp|A9IR81|DAPE_BORPD Succinyl-diaminopimelate desuccinylase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dapE PE=3 SV=1 160 541 6.0E-07
sp|Q6LXF3|Y1398_METMP Uncharacterized metallohydrolase MMP1398 OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1398 PE=1 SV=1 163 304 6.0E-07
sp|B8CMP0|DAPE_SHEPW Succinyl-diaminopimelate desuccinylase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dapE PE=3 SV=1 161 304 6.0E-07
sp|B9MJL1|DAPE_ACIET Succinyl-diaminopimelate desuccinylase OS=Acidovorax ebreus (strain TPSY) GN=dapE PE=3 SV=1 159 304 7.0E-07
sp|A5UFQ7|DAPE_HAEIG Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain PittGG) GN=dapE PE=3 SV=1 165 261 7.0E-07
sp|A1W7M0|DAPE_ACISJ Succinyl-diaminopimelate desuccinylase OS=Acidovorax sp. (strain JS42) GN=dapE PE=3 SV=1 159 304 7.0E-07
sp|Q4FU86|DAPE_PSYA2 Succinyl-diaminopimelate desuccinylase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dapE PE=3 SV=1 136 304 7.0E-07
sp|Q0I1X3|DAPE_HAES1 Succinyl-diaminopimelate desuccinylase OS=Haemophilus somnus (strain 129Pt) GN=dapE PE=3 SV=1 159 261 9.0E-07
sp|Q7MIL6|DAPE_VIBVY Succinyl-diaminopimelate desuccinylase OS=Vibrio vulnificus (strain YJ016) GN=dapE PE=3 SV=2 161 252 9.0E-07
sp|A5WD56|DAPE_PSYWF Succinyl-diaminopimelate desuccinylase OS=Psychrobacter sp. (strain PRwf-1) GN=dapE PE=3 SV=1 114 325 1.0E-06
sp|A4G4Q7|DAPE_HERAR Succinyl-diaminopimelate desuccinylase OS=Herminiimonas arsenicoxydans GN=dapE PE=3 SV=1 159 304 1.0E-06
sp|Q6D7N4|DAPE_PECAS Succinyl-diaminopimelate desuccinylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dapE PE=3 SV=1 159 261 1.0E-06
sp|A9BZY6|DAPE_DELAS Succinyl-diaminopimelate desuccinylase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dapE PE=3 SV=1 153 304 1.0E-06
sp|B9J8D0|DAPE_AGRRK Succinyl-diaminopimelate desuccinylase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dapE PE=3 SV=1 161 304 1.0E-06
sp|A4VMY9|DAPE_PSEU5 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas stutzeri (strain A1501) GN=dapE PE=3 SV=1 160 304 1.0E-06
sp|Q4ZWU0|DAPE_PSEU2 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dapE PE=3 SV=1 155 304 1.0E-06
sp|B2HY23|DAPE_ACIBC Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain ACICU) GN=dapE PE=3 SV=1 161 304 1.0E-06
sp|Q15TS8|DAPE_PSEA6 Succinyl-diaminopimelate desuccinylase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dapE PE=3 SV=1 161 304 1.0E-06
sp|A4SPS7|DAPE_AERS4 Succinyl-diaminopimelate desuccinylase OS=Aeromonas salmonicida (strain A449) GN=dapE PE=3 SV=1 161 235 1.0E-06
sp|Q48F49|DAPE_PSE14 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dapE PE=3 SV=1 155 304 1.0E-06
sp|Q47Z95|DAPE_COLP3 Succinyl-diaminopimelate desuccinylase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dapE PE=3 SV=1 161 304 1.0E-06
sp|Q1R039|DAPE_CHRSD Succinyl-diaminopimelate desuccinylase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dapE PE=3 SV=1 160 252 1.0E-06
sp|B0VRY3|DAPE_ACIBS Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain SDF) GN=dapE PE=3 SV=1 161 304 1.0E-06
sp|A1RJ78|DAPE_SHESW Succinyl-diaminopimelate desuccinylase OS=Shewanella sp. (strain W3-18-1) GN=dapE PE=3 SV=1 161 304 1.0E-06
sp|A4Y7B1|DAPE_SHEPC Succinyl-diaminopimelate desuccinylase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dapE PE=3 SV=1 161 304 1.0E-06
sp|B7VIL8|DAPE_VIBTL Succinyl-diaminopimelate desuccinylase OS=Vibrio tasmaniensis (strain LGP32) GN=dapE PE=3 SV=1 161 304 2.0E-06
sp|B0V4V8|DAPE_ACIBY Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AYE) GN=dapE PE=3 SV=1 161 304 2.0E-06
sp|B7I842|DAPE_ACIB5 Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AB0057) GN=dapE PE=3 SV=1 161 304 2.0E-06
sp|B7GXA3|DAPE_ACIB3 Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AB307-0294) GN=dapE PE=3 SV=1 161 304 2.0E-06
sp|A3M8H2|DAPE_ACIBT Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dapE PE=3 SV=2 161 304 2.0E-06
sp|A6SZR5|DAPE_JANMA Succinyl-diaminopimelate desuccinylase OS=Janthinobacterium sp. (strain Marseille) GN=dapE PE=3 SV=1 159 304 2.0E-06
sp|A1WEL1|DAPE_VEREI Succinyl-diaminopimelate desuccinylase OS=Verminephrobacter eiseniae (strain EF01-2) GN=dapE PE=3 SV=1 152 304 2.0E-06
sp|Q12C18|DAPE_POLSJ Succinyl-diaminopimelate desuccinylase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dapE PE=3 SV=1 152 304 2.0E-06
sp|A4XWV4|DAPE_PSEMY Succinyl-diaminopimelate desuccinylase OS=Pseudomonas mendocina (strain ymp) GN=dapE PE=3 SV=1 160 304 2.0E-06
sp|Q083F0|DAPE_SHEFN Succinyl-diaminopimelate desuccinylase OS=Shewanella frigidimarina (strain NCIMB 400) GN=dapE PE=3 SV=1 161 322 2.0E-06
sp|Q2KD47|DAPE_RHIEC Succinyl-diaminopimelate desuccinylase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dapE PE=3 SV=2 161 304 2.0E-06
sp|A1JL17|DAPE_YERE8 Succinyl-diaminopimelate desuccinylase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dapE PE=3 SV=1 165 261 2.0E-06
sp|Q470C3|DAPE_CUPPJ Succinyl-diaminopimelate desuccinylase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dapE PE=3 SV=1 155 261 2.0E-06
sp|B1JSH5|DAPE_YERPY Succinyl-diaminopimelate desuccinylase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dapE PE=3 SV=1 165 261 2.0E-06
sp|Q668G5|DAPE_YERPS Succinyl-diaminopimelate desuccinylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dapE PE=3 SV=1 165 261 2.0E-06
sp|A4TMM3|DAPE_YERPP Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis (strain Pestoides F) GN=dapE PE=3 SV=1 165 261 2.0E-06
sp|Q1CK18|DAPE_YERPN Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dapE PE=3 SV=1 165 261 2.0E-06
sp|A9R2H7|DAPE_YERPG Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dapE PE=3 SV=1 165 261 2.0E-06
sp|Q7CJI9|DAPE_YERPE Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis GN=dapE PE=3 SV=1 165 261 2.0E-06
sp|B2K985|DAPE_YERPB Succinyl-diaminopimelate desuccinylase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dapE PE=3 SV=1 165 261 2.0E-06
sp|Q1C5R3|DAPE_YERPA Succinyl-diaminopimelate desuccinylase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dapE PE=3 SV=1 165 261 2.0E-06
sp|Q7VF72|DAPE_HELHP Succinyl-diaminopimelate desuccinylase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=dapE PE=3 SV=1 156 320 3.0E-06
sp|B0T134|DAPE_CAUSK Succinyl-diaminopimelate desuccinylase OS=Caulobacter sp. (strain K31) GN=dapE PE=3 SV=2 159 328 3.0E-06
sp|A3QE30|DAPE1_SHELP Succinyl-diaminopimelate desuccinylase 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dapE1 PE=3 SV=1 161 327 3.0E-06
sp|A2SGS4|DAPE_METPP Succinyl-diaminopimelate desuccinylase OS=Methylibium petroleiphilum (strain PM1) GN=dapE PE=3 SV=1 153 304 3.0E-06
sp|A7MY37|DAPE_VIBCB Succinyl-diaminopimelate desuccinylase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dapE PE=3 SV=1 161 304 3.0E-06
sp|A8FW04|DAPE_SHESH Succinyl-diaminopimelate desuccinylase OS=Shewanella sediminis (strain HAW-EB3) GN=dapE PE=3 SV=1 161 304 3.0E-06
sp|A7FG57|DAPE_YERP3 Succinyl-diaminopimelate desuccinylase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dapE PE=3 SV=1 165 261 3.0E-06
sp|A1WX26|DAPE_HALHL Succinyl-diaminopimelate desuccinylase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dapE PE=3 SV=1 161 304 4.0E-06
sp|Q82XY4|DAPE_NITEU Succinyl-diaminopimelate desuccinylase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dapE PE=3 SV=1 148 264 4.0E-06
sp|A6V936|DAPE_PSEA7 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain PA7) GN=dapE PE=3 SV=1 160 304 4.0E-06
sp|A5CXE9|DAPE_VESOH Succinyl-diaminopimelate desuccinylase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=dapE PE=3 SV=1 161 249 4.0E-06
sp|A1S647|DAPE_SHEAM Succinyl-diaminopimelate desuccinylase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dapE PE=3 SV=1 161 304 5.0E-06
sp|Q886Q4|DAPE_PSESM Succinyl-diaminopimelate desuccinylase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dapE PE=3 SV=1 160 304 5.0E-06
sp|Q2NS82|DAPE_SODGM Succinyl-diaminopimelate desuccinylase OS=Sodalis glossinidius (strain morsitans) GN=dapE PE=3 SV=1 165 304 5.0E-06
sp|Q63T00|DAPE_BURPS Succinyl-diaminopimelate desuccinylase OS=Burkholderia pseudomallei (strain K96243) GN=dapE PE=3 SV=2 159 264 5.0E-06
sp|A3NAW2|DAPE_BURP6 Succinyl-diaminopimelate desuccinylase OS=Burkholderia pseudomallei (strain 668) GN=dapE PE=3 SV=1 159 264 5.0E-06
sp|A3NWP5|DAPE_BURP0 Succinyl-diaminopimelate desuccinylase OS=Burkholderia pseudomallei (strain 1106a) GN=dapE PE=3 SV=1 159 264 5.0E-06
sp|A4JF88|DAPE_BURVG Succinyl-diaminopimelate desuccinylase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dapE PE=3 SV=1 154 264 6.0E-06
sp|B2JID9|DAPE_BURP8 Succinyl-diaminopimelate desuccinylase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dapE PE=3 SV=1 159 304 6.0E-06
sp|A8GHK9|DAPE_SERP5 Succinyl-diaminopimelate desuccinylase OS=Serratia proteamaculans (strain 568) GN=dapE PE=3 SV=1 165 261 6.0E-06
sp|Q31G37|DAPE_THICR Succinyl-diaminopimelate desuccinylase OS=Thiomicrospira crunogena (strain XCL-2) GN=dapE PE=3 SV=1 161 322 6.0E-06
sp|A9AHS8|DAPE_BURM1 Succinyl-diaminopimelate desuccinylase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dapE PE=3 SV=1 157 264 7.0E-06
sp|Q12N78|DAPE_SHEDO Succinyl-diaminopimelate desuccinylase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dapE PE=3 SV=1 161 304 7.0E-06
sp|A9CKC4|DAPE_AGRFC Succinyl-diaminopimelate desuccinylase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dapE PE=3 SV=1 161 304 7.0E-06
sp|P45494|PEPV_LACDL Beta-Ala-Xaa dipeptidase OS=Lactobacillus delbrueckii subsp. lactis GN=pepV PE=1 SV=1 159 237 7.0E-06
sp|C4LDG0|DAPE_TOLAT Succinyl-diaminopimelate desuccinylase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dapE PE=3 SV=1 161 319 7.0E-06
sp|Q2SX11|DAPE_BURTA Succinyl-diaminopimelate desuccinylase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dapE PE=3 SV=2 159 264 7.0E-06
sp|Q058B2|DAPE_BUCCC Succinyl-diaminopimelate desuccinylase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dapE PE=3 SV=1 159 342 8.0E-06
sp|Q2GHW1|DAPE_EHRCR Succinyl-diaminopimelate desuccinylase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dapE PE=3 SV=1 161 328 8.0E-06
sp|Q3J9B0|DAPE_NITOC Succinyl-diaminopimelate desuccinylase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dapE PE=3 SV=1 161 264 8.0E-06
sp|A1AVU9|DAPE_RUTMC Succinyl-diaminopimelate desuccinylase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dapE PE=3 SV=1 161 322 9.0E-06
sp|Q16DM9|DAPE_ROSDO Succinyl-diaminopimelate desuccinylase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dapE PE=3 SV=1 143 304 9.0E-06
sp|B3PBB9|DAPE_CELJU Succinyl-diaminopimelate desuccinylase OS=Cellvibrio japonicus (strain Ueda107) GN=dapE PE=3 SV=2 160 304 9.0E-06
sp|Q3JR15|DAPE_BURP1 Succinyl-diaminopimelate desuccinylase OS=Burkholderia pseudomallei (strain 1710b) GN=dapE PE=3 SV=2 159 264 9.0E-06
sp|A1V584|DAPE_BURMS Succinyl-diaminopimelate desuccinylase OS=Burkholderia mallei (strain SAVP1) GN=dapE PE=3 SV=1 159 264 9.0E-06
sp|Q62JB1|DAPE_BURMA Succinyl-diaminopimelate desuccinylase OS=Burkholderia mallei (strain ATCC 23344) GN=dapE PE=3 SV=1 159 264 9.0E-06
sp|A2SB58|DAPE_BURM9 Succinyl-diaminopimelate desuccinylase OS=Burkholderia mallei (strain NCTC 10229) GN=dapE PE=3 SV=1 159 264 9.0E-06
sp|A3MKV8|DAPE_BURM7 Succinyl-diaminopimelate desuccinylase OS=Burkholderia mallei (strain NCTC 10247) GN=dapE PE=3 SV=1 159 264 9.0E-06
sp|Q6NC49|DAPE_RHOPA Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dapE PE=3 SV=1 161 322 9.0E-06
sp|C3LPF7|DAPE_VIBCM Succinyl-diaminopimelate desuccinylase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dapE PE=3 SV=1 153 252 1.0E-05
sp|Q9KQ52|DAPE_VIBCH Succinyl-diaminopimelate desuccinylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dapE PE=1 SV=1 153 252 1.0E-05
sp|A5F6B5|DAPE_VIBC3 Succinyl-diaminopimelate desuccinylase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dapE PE=3 SV=1 153 252 1.0E-05
sp|Q492F7|DAPE_BLOPB Succinyl-diaminopimelate desuccinylase OS=Blochmannia pennsylvanicus (strain BPEN) GN=dapE PE=3 SV=1 161 304 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|065630
MKWLRPAILRTDCRRPLHRNIRAILDRQRWALYPTKPNRQARVEICLDIHGVSYYSAQCHGSVCAQPFPPANRST
YSDAYDSPEFKKRSALRLSGAVKIPTMSFDDMGPIHEDERWKPFPEMHQYLETTFPIVHAHATREVVGGYSLVYT
LEGSSSDLKPFMLMAHMDVVPALTALDHWTYPPFEGKIDGDWLYGRGAADCKNNLIGILSALEHLLESGWKPRRS
IVLAFGQDEEISGHYGAASVGRHLTSRYGEQSFAMIVDEGGSGLDTVYGRDFAFPGVAEKGYLNAIITVEMAGGH
SSVPTPHTSIGILSKIVSKLEDYEMFRPHIKRESPIWGYLNCVATYGKKSQVPKWIQEAVASTKPDFDSIAKSFA
ETSPPSRYLVQTSKVATIFNAGVKENAMAEAATVYFNNRINIFSSTSEVAQRYTELILPIAKQYSLNLQGKSYSQ
EPSIGNITIEWNDPLEPSPISPTTIDNVAWESFMKAVQASFGSGVITTPSGGTGNTDTRHFWNLTHNIYRWSPSR
IGTRLNIHTVDEKIKIDTHIEGIRFYTELILIVDEATDAF*
Coding >AgabiH97|065630
ATGAAATGGCTACGGCCCGCCATCCTGAGAACCGATTGCCGGCGGCCACTTCACCGTAACATCCGTGCAATACTC
GACAGGCAACGATGGGCACTTTACCCTACCAAACCCAACCGCCAAGCTCGAGTCGAAATTTGCCTGGATATACAT
GGCGTCTCTTACTACTCGGCACAATGTCATGGTAGTGTCTGCGCTCAGCCATTTCCCCCTGCAAACAGGTCCACT
TATTCAGATGCATACGACTCTCCCGAGTTCAAGAAGCGAAGCGCTTTGCGGCTTTCAGGAGCCGTGAAGATCCCT
ACCATGTCTTTCGACGATATGGGACCTATACATGAAGATGAACGTTGGAAGCCATTTCCTGAAATGCACCAATAT
CTTGAGACGACGTTTCCGATTGTACATGCGCATGCCACTCGCGAGGTTGTTGGAGGATACTCTCTCGTGTACACC
CTGGAAGGGTCTTCCTCAGATCTCAAACCCTTCATGCTCATGGCTCACATGGATGTTGTCCCAGCCCTCACTGCA
TTAGACCATTGGACCTATCCGCCATTCGAAGGCAAGATCGATGGGGACTGGCTTTATGGTCGTGGTGCCGCAGAT
TGCAAGAACAACTTGATTGGTATTTTGTCTGCACTGGAGCATCTTTTGGAATCAGGTTGGAAACCCAGGAGGTCT
ATTGTGCTCGCTTTTGGGCAGGATGAAGAAATCAGCGGTCACTATGGTGCAGCAAGTGTCGGACGACATCTCACA
AGTAGATACGGTGAACAAAGTTTCGCCATGATCGTTGATGAGGGCGGTTCGGGTCTCGACACAGTATATGGACGT
GATTTTGCCTTTCCTGGAGTTGCAGAAAAAGGTTATCTGAATGCCATCATCACTGTTGAGATGGCAGGGGGACAT
TCTTCCGTTCCGACGCCACACACAAGCATTGGCATCCTATCAAAGATCGTCTCAAAACTCGAGGATTATGAAATG
TTCCGCCCTCATATTAAACGAGAAAGTCCTATTTGGGGTTACTTGAATTGTGTTGCAACATACGGCAAAAAAAGT
CAAGTACCAAAATGGATACAGGAAGCGGTGGCTAGTACCAAGCCTGACTTTGATTCTATTGCCAAGAGTTTCGCC
GAGACGTCACCTCCGAGTCGTTACCTCGTTCAGACGTCCAAAGTAGCGACAATTTTCAATGCCGGCGTCAAAGAA
AATGCTATGGCCGAGGCTGCTACGGTTTACTTCAACAACCGTATCAATATATTCAGTTCGACTAGCGAAGTCGCT
CAGCGCTACACTGAGCTCATTCTGCCTATAGCAAAGCAATATTCTTTGAATCTTCAAGGAAAGTCGTACTCACAG
GAACCTTCGATCGGCAACATCACGATTGAATGGAATGATCCTCTTGAGCCTAGTCCCATTTCGCCAACGACCATC
GACAATGTAGCATGGGAATCATTTATGAAAGCAGTTCAAGCTTCGTTTGGATCCGGTGTCATCACAACTCCAAGC
GGTGGGACAGGAAACACAGATACGCGTCATTTCTGGAATTTGACGCACAACATTTACCGCTGGAGTCCTTCACGT
ATTGGCACAAGACTGAACATTCATACTGTGGATGAGAAGATCAAAATTGACACCCACATTGAAGGAATCCGCTTC
TATACTGAGCTTATCCTCATCGTCGACGAGGCGACTGACGCGTTCTGA
Transcript >AgabiH97|065630
ATGAAATGGCTACGGCCCGCCATCCTGAGAACCGATTGCCGGCGGCCACTTCACCGTAACATCCGTGCAATACTC
GACAGGCAACGATGGGCACTTTACCCTACCAAACCCAACCGCCAAGCTCGAGTCGAAATTTGCCTGGATATACAT
GGCGTCTCTTACTACTCGGCACAATGTCATGGTAGTGTCTGCGCTCAGCCATTTCCCCCTGCAAACAGGTCCACT
TATTCAGATGCATACGACTCTCCCGAGTTCAAGAAGCGAAGCGCTTTGCGGCTTTCAGGAGCCGTGAAGATCCCT
ACCATGTCTTTCGACGATATGGGACCTATACATGAAGATGAACGTTGGAAGCCATTTCCTGAAATGCACCAATAT
CTTGAGACGACGTTTCCGATTGTACATGCGCATGCCACTCGCGAGGTTGTTGGAGGATACTCTCTCGTGTACACC
CTGGAAGGGTCTTCCTCAGATCTCAAACCCTTCATGCTCATGGCTCACATGGATGTTGTCCCAGCCCTCACTGCA
TTAGACCATTGGACCTATCCGCCATTCGAAGGCAAGATCGATGGGGACTGGCTTTATGGTCGTGGTGCCGCAGAT
TGCAAGAACAACTTGATTGGTATTTTGTCTGCACTGGAGCATCTTTTGGAATCAGGTTGGAAACCCAGGAGGTCT
ATTGTGCTCGCTTTTGGGCAGGATGAAGAAATCAGCGGTCACTATGGTGCAGCAAGTGTCGGACGACATCTCACA
AGTAGATACGGTGAACAAAGTTTCGCCATGATCGTTGATGAGGGCGGTTCGGGTCTCGACACAGTATATGGACGT
GATTTTGCCTTTCCTGGAGTTGCAGAAAAAGGTTATCTGAATGCCATCATCACTGTTGAGATGGCAGGGGGACAT
TCTTCCGTTCCGACGCCACACACAAGCATTGGCATCCTATCAAAGATCGTCTCAAAACTCGAGGATTATGAAATG
TTCCGCCCTCATATTAAACGAGAAAGTCCTATTTGGGGTTACTTGAATTGTGTTGCAACATACGGCAAAAAAAGT
CAAGTACCAAAATGGATACAGGAAGCGGTGGCTAGTACCAAGCCTGACTTTGATTCTATTGCCAAGAGTTTCGCC
GAGACGTCACCTCCGAGTCGTTACCTCGTTCAGACGTCCAAAGTAGCGACAATTTTCAATGCCGGCGTCAAAGAA
AATGCTATGGCCGAGGCTGCTACGGTTTACTTCAACAACCGTATCAATATATTCAGTTCGACTAGCGAAGTCGCT
CAGCGCTACACTGAGCTCATTCTGCCTATAGCAAAGCAATATTCTTTGAATCTTCAAGGAAAGTCGTACTCACAG
GAACCTTCGATCGGCAACATCACGATTGAATGGAATGATCCTCTTGAGCCTAGTCCCATTTCGCCAACGACCATC
GACAATGTAGCATGGGAATCATTTATGAAAGCAGTTCAAGCTTCGTTTGGATCCGGTGTCATCACAACTCCAAGC
GGTGGGACAGGAAACACAGATACGCGTCATTTCTGGAATTTGACGCACAACATTTACCGCTGGAGTCCTTCACGT
ATTGGCACAAGACTGAACATTCATACTGTGGATGAGAAGATCAAAATTGACACCCACATTGAAGGAATCCGCTTC
TATACTGAGCTTATCCTCATCGTCGACGAGGCGACTGACGCGTTCTGA
Gene >AgabiH97|065630
ATGAAATGGCTACGGCGTGAGTCTTGCTTTTCCCACGATACAGTCAGCTGAATTATAGGTTGAACATAAGCCGCC
ATGTAAGTATTCTAGTCAAGTCATGTGAAGGCCTACCATTGGATATTAACAAACGTTTAGCCTGAGAACCGATTG
CCGGCGGCCACTTCACCGTAACATCCGTGCAATACTCGACAGGCAACGATGGGCACTTTACCCTACCAAACCCAA
CCGCCAAGCTCGAGTCGAAATTTGCCTGGATATACATGGCGTCTCTTACTACTCGGGTCACTCATTGTTACCGGC
CTTTTTTTCCAACCTTGGCCCCTGAACCGATGGCTTGATAACAACTTTCAAGCACAATGTCATGGTAGTGTCTGC
GCTCAGCCATTTCCCCCTGCAAACAGGTCCACTTATTCAGATGCATACGACTCTCCCGAGTTCAAGAAGCGAAGC
GCTTTGCGGCTTTCAGGAGCCGTGAAGATCCCTACCATGTCTGTAGCATCTGTGCTTCATGATCTTGTAACTCAA
ATGCATCAGGTCTTTCGACGATATGGGACCTATACATGAAGATGAACGTTGGAAGCCATTTCCTGAAATGCACCA
ATATCTTGAGACGACGTTTCCGATTGTGTATGTGCTAATGTTTCGGCTTATATCTCCCTTACCTTTCGTAGACAT
GCGCATGCCACTCGCGAGGTTGTTGGAGGATACTCTCTCGTGTACACCCTGGAAGGGTCTTCCTCAGATCTCAAA
CCCTTCATGCTCATGGCTCACATGGATGTTGTCCCAGCGTGAGTTTCCTTTCAGACTTTCTGAACCGATGTAGAT
CTCGATATTTGCCAGCCTCACTGCATTAGACCATTGGACCTATCCGCCATTCGAAGGCAAGATCGATGGGGACTG
GCTTTATGGTCGTGGTGCCGCAGATTGCAAGAACAACTTGATTGGTATTTTGTCTGCACTGGAGCATCTTTTGGA
ATCAGGTTGGAAACCCAGGAGGTCTATTGGTAAGTTGATTTTGATGTCGTAAGTTCAGGATACTTATAGACATAG
TGCTCGCTTTTGGGCAGGATGAAGAAATCAGCGGTCACTATGGTGCAGCAAGTGTCGGACGACATCTCACAAGTA
GATACGGTGAACAAAGTTTCGCCATGATCGTTGATGAGGGCGGTTCGGGTCTCGACACAGTATATGGACGTGATT
TTGCCTTTCCTGGAGTTGCAGAAAAAGGTTATCTGGTGAGTATCTTTAGCTGGCTGATTACCGACTTGAGTATTC
ATTGGAATGTATAGAATGCCATCATCACTGTTGAGATGGCAGGGGGACAGTGAGTTCATTGGTACCCTCGTAATG
GAGTCGAATTAATTCGGCGATTCTCAGTTCTTCCGTTCCGACGCCACACACAAGCATTGGCATCCTATCAAAGAT
CGTCTCAAAACTCGAGTAAGGTCATCGCTGGCAGGGTTGTGCTATGGCTGAACCCGCCACTAGGGATTATGAAAT
GTTCCGCCCTCATATTAAACGAGAAAGTCCTATTTGGGGTTACTTGAATTGTGTTGCAACATACGGCAAAAAAAG
TCAAGTACCAAAATGGATACAGGAAGCGGTGGCTAGTACCAAGCCTGACTTTGATTCTATTGCCAAGAGTTTCGC
CGAGACGTCACCTCCGAGTCGTTACCTCGTTCAGACGTCCAAAGTAGCGACAATTTTCAATGCCGGCGTCAAAGT
GAGCGACCCTGTTTCCATGCCACTCTCCATGGACTTCTCCGCGGCCTTTGATTCTATGACGTTCTTTCAACTTTT
CTCAACGTGAACTGTCTATCATTGCTGATGGTTTTCTAGGAAAATGCTATGGCCGAGGCTGCTACGGTTTACTTC
AACAACCGTATCAATATATTCAGTTCGAGTTAAGGACATCAATACTGGCACTATATCCACTTACCTAATTTTCTC
ATCAGCTAGCGAAGTCGCTCAGCGCTACACTGAGCTCATTCTGCCTATAGCAAAGCAATATTCTTTGAATCTTCA
AGGAAAGTCGTACTCACAGGAACCTTCGATCGGCAACATCACGATTGAATGGAATGATCCTCTTGAGCCTAGTCC
CATTTCGCCAACGACCATCGACAATGTAGCATGGGAATCATTTATGAAAGCAGTTCAAGCTTCGTTTGGATCCGG
TGTCATCACAACTCCAAGCGGTGGGACAGGAAACACAGGCGAGTCGGTTATCATTGATGCTTCGTCCTCAAATAT
TGACATCAGGATCATATCTCAGATACGCGTCATTTCGTGAGCGCTCGTGACTAAATTTGGTGAACATAAAGAATT
AACCATGGATACGTGACACGTTGGGGTTGTGTGCCCGTAGTGGAATTTGTAGGTGCCGTTATCTGTCTCGCTTAG
CCGCCATTCACCTGATTTATCTCAAGGACGCACAACATTTACCGCTGGAGTCCTTCACGTATTGGCACAAGGTAC
CCTTTGATCTCCTAGCGACGTTTCCGCGAATCGTTAATGGTTGACAGACTGAACATTCATACTGTGGATGAGAAG
ATCAGTAAGTTTAGCGCGCAATACCATGTGAAGAAGCTGAACCGCTTCCAGAAATTGACACCCACATTGAAGGAA
TCCGCTTCTATACTGGTACGTTGTTGAACGAGTTCATTCTTACCACTGGACAACTGGTGACCTTTTCTATCCCAG
AGCTTATCCTCATCGTCGACGAGGCGACTGACGCGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail