Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|065410
Gene name
Locationscaffold_3:3109560..3111554
Strand+
Gene length (bp)1994
Transcript length (bp)1713
Coding sequence length (bp)1713
Protein length (aa) 571

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.3E-20 130 271
PF08031 BBE Berberine and berberine like 1.5E-07 520 562

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 27 562 1.0E-92
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 1 562 8.0E-89
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 130 568 3.0E-10
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 130 341 3.0E-08
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 248 564 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 27 562 1.0E-92
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 1 562 8.0E-89
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 130 568 3.0E-10
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 130 341 3.0E-08
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 248 564 3.0E-08
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 130 317 2.0E-07
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 126 311 2.0E-06
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 126 565 6.0E-06
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 124 305 8.0E-06
sp|P46377|FAS5_RHOFA Uncharacterized oxidoreductase ORF5 in fasciation locus OS=Rhodococcus fascians GN=fas5 PE=2 SV=1 132 303 8.0E-06
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 130 565 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|065410
MRLHALLDFIPFLSLVLAQSKEDVKCRCLYGEPCWPTEQDFTSLTSHLSQPLLRPVPPATACYPIDNPSGNCSDA
QSHLRDSIWRADQPGAYENINFESHLFQNGSISACYLNTTLGIPCEQGNVPPIGVVARTVEDVQAAVKFAGQHNL
RLVVKNTGHDYLGRSSGRNAFMIWTHHLKNITYNAEFIPEGGSKDDAIFGLTVGAGVQWHEAYDVAAQNNRFIVG
GISASGSVGAAGGWIMGGGHSAFSPKFGLGVDNAVEFTIVKPNGDYAVANSHHNQDLFWALRGGGAGSWGVVISV
TYKTHDLLPMILSVLNVTFPTLDAATSVATELVGLFPKLSDLGWGGYGALSNTSLLMGFMSPNVSWADVNSTILP
FFDFAVNATQDPNALATTIPFANPYELINPSDDAGLQNAQEVGGLVELASRLLSRNAAEQRAEETARLLLSFDFV
GINFVAGGAVGRAEPDSVALNPGWRKAVAHVYTSGNWEEGTSAETIEEIQRGVARHVRALDPISPDSTTYMNEAS
LYEPDFKKSFFGDHYDKLRAIKQIYDPSSLFVVAEGVHPMSGMIH*
Coding >AgabiH97|065410
ATGAGACTCCACGCTTTGCTTGACTTCATACCCTTCCTCTCCCTTGTGCTCGCGCAGTCGAAGGAAGATGTTAAA
TGTCGATGTCTGTATGGCGAACCTTGTTGGCCTACTGAGCAAGACTTTACCTCTCTTACCTCCCATCTGTCCCAA
CCCCTCCTCCGTCCCGTACCTCCCGCTACTGCTTGCTATCCCATTGACAACCCATCTGGTAACTGTTCCGACGCA
CAGAGCCATCTGCGTGACTCGATCTGGCGTGCTGACCAACCTGGTGCATACGAGAATATCAATTTCGAGTCTCAC
CTCTTCCAAAACGGTTCTATCAGTGCTTGTTATCTCAACACTACCCTCGGAATTCCATGTGAGCAGGGGAATGTT
CCTCCCATTGGCGTCGTTGCTAGGACGGTGGAAGATGTACAAGCAGCGGTGAAGTTTGCTGGCCAGCACAACCTC
CGGCTGGTCGTCAAGAATACAGGACATGATTATCTCGGCCGTAGCTCTGGACGGAACGCTTTCATGATTTGGACA
CATCATTTGAAGAACATAACTTATAACGCCGAATTTATCCCAGAAGGCGGTTCGAAGGACGATGCTATTTTCGGC
TTGACTGTGGGCGCCGGTGTTCAATGGCACGAAGCTTACGACGTTGCTGCTCAGAACAACCGCTTCATTGTTGGT
GGTATTTCTGCATCAGGGTCCGTTGGAGCTGCAGGCGGCTGGATCATGGGTGGTGGTCACAGCGCATTCTCTCCA
AAATTTGGCCTAGGAGTGGACAACGCTGTCGAGTTCACTATTGTGAAACCGAATGGTGATTATGCCGTTGCCAAC
TCTCACCATAACCAAGACCTCTTCTGGGCGCTGAGAGGCGGTGGTGCAGGTTCTTGGGGAGTCGTCATTTCTGTG
ACCTACAAAACACATGATTTACTTCCAATGATTTTGTCCGTTCTTAATGTCACCTTCCCTACCCTGGATGCTGCG
ACAAGTGTCGCCACGGAGCTCGTCGGGCTTTTCCCCAAGCTTTCCGACTTAGGCTGGGGAGGTTATGGAGCTCTT
TCAAATACGAGCCTATTAATGGGATTTATGTCCCCAAATGTCTCGTGGGCAGATGTCAATTCCACCATCCTTCCT
TTCTTTGATTTCGCCGTAAATGCTACTCAAGACCCCAATGCTCTCGCTACCACTATACCTTTTGCTAATCCTTAT
GAGCTCATCAATCCCAGCGATGATGCAGGGCTCCAGAACGCCCAGGAGGTCGGGGGCCTGGTAGAACTTGCATCC
CGGCTATTATCCCGCAATGCTGCCGAGCAGAGAGCAGAAGAGACAGCACGGCTTCTTTTGAGCTTTGATTTTGTT
GGTATCAATTTCGTTGCGGGTGGAGCTGTCGGGCGTGCTGAACCAGATTCCGTTGCTCTTAACCCGGGGTGGAGA
AAAGCTGTAGCTCATGTATACACGTCAGGGAATTGGGAAGAAGGTACTTCGGCTGAAACCATAGAAGAGATTCAG
CGAGGTGTTGCACGACATGTGAGAGCCTTGGATCCTATTTCTCCGGATTCAACAACCTACATGAACGAGGCATCG
TTATACGAGCCGGACTTCAAGAAGTCATTCTTTGGCGACCATTACGACAAATTAAGGGCCATTAAACAAATATAT
GACCCCAGCTCGTTGTTCGTTGTCGCTGAAGGTGTACATCCGATGAGTGGGATGATACATTGA
Transcript >AgabiH97|065410
ATGAGACTCCACGCTTTGCTTGACTTCATACCCTTCCTCTCCCTTGTGCTCGCGCAGTCGAAGGAAGATGTTAAA
TGTCGATGTCTGTATGGCGAACCTTGTTGGCCTACTGAGCAAGACTTTACCTCTCTTACCTCCCATCTGTCCCAA
CCCCTCCTCCGTCCCGTACCTCCCGCTACTGCTTGCTATCCCATTGACAACCCATCTGGTAACTGTTCCGACGCA
CAGAGCCATCTGCGTGACTCGATCTGGCGTGCTGACCAACCTGGTGCATACGAGAATATCAATTTCGAGTCTCAC
CTCTTCCAAAACGGTTCTATCAGTGCTTGTTATCTCAACACTACCCTCGGAATTCCATGTGAGCAGGGGAATGTT
CCTCCCATTGGCGTCGTTGCTAGGACGGTGGAAGATGTACAAGCAGCGGTGAAGTTTGCTGGCCAGCACAACCTC
CGGCTGGTCGTCAAGAATACAGGACATGATTATCTCGGCCGTAGCTCTGGACGGAACGCTTTCATGATTTGGACA
CATCATTTGAAGAACATAACTTATAACGCCGAATTTATCCCAGAAGGCGGTTCGAAGGACGATGCTATTTTCGGC
TTGACTGTGGGCGCCGGTGTTCAATGGCACGAAGCTTACGACGTTGCTGCTCAGAACAACCGCTTCATTGTTGGT
GGTATTTCTGCATCAGGGTCCGTTGGAGCTGCAGGCGGCTGGATCATGGGTGGTGGTCACAGCGCATTCTCTCCA
AAATTTGGCCTAGGAGTGGACAACGCTGTCGAGTTCACTATTGTGAAACCGAATGGTGATTATGCCGTTGCCAAC
TCTCACCATAACCAAGACCTCTTCTGGGCGCTGAGAGGCGGTGGTGCAGGTTCTTGGGGAGTCGTCATTTCTGTG
ACCTACAAAACACATGATTTACTTCCAATGATTTTGTCCGTTCTTAATGTCACCTTCCCTACCCTGGATGCTGCG
ACAAGTGTCGCCACGGAGCTCGTCGGGCTTTTCCCCAAGCTTTCCGACTTAGGCTGGGGAGGTTATGGAGCTCTT
TCAAATACGAGCCTATTAATGGGATTTATGTCCCCAAATGTCTCGTGGGCAGATGTCAATTCCACCATCCTTCCT
TTCTTTGATTTCGCCGTAAATGCTACTCAAGACCCCAATGCTCTCGCTACCACTATACCTTTTGCTAATCCTTAT
GAGCTCATCAATCCCAGCGATGATGCAGGGCTCCAGAACGCCCAGGAGGTCGGGGGCCTGGTAGAACTTGCATCC
CGGCTATTATCCCGCAATGCTGCCGAGCAGAGAGCAGAAGAGACAGCACGGCTTCTTTTGAGCTTTGATTTTGTT
GGTATCAATTTCGTTGCGGGTGGAGCTGTCGGGCGTGCTGAACCAGATTCCGTTGCTCTTAACCCGGGGTGGAGA
AAAGCTGTAGCTCATGTATACACGTCAGGGAATTGGGAAGAAGGTACTTCGGCTGAAACCATAGAAGAGATTCAG
CGAGGTGTTGCACGACATGTGAGAGCCTTGGATCCTATTTCTCCGGATTCAACAACCTACATGAACGAGGCATCG
TTATACGAGCCGGACTTCAAGAAGTCATTCTTTGGCGACCATTACGACAAATTAAGGGCCATTAAACAAATATAT
GACCCCAGCTCGTTGTTCGTTGTCGCTGAAGGTGTACATCCGATGAGTGGGATGATACATTGA
Gene >AgabiH97|065410
ATGAGACTCCACGCTTTGCTTGACTTCATACCCTTCCTCTCCCTTGTGCTCGCGCAGTCGAAGGAAGATGTTAAA
TGTCGATGTCTGTATGGCGAACCTTGTTGGCCTACTGAGCAAGACTTTACCTCTCTTACCTCCCATCTGTCCCAA
CCCCTCCTCCGTCCCGTACCTCCCGCTACTGCTTGCTATCCCATTGACAACCCATCTGGTAACTGTTCCGACGCA
CAGAGCCATCTGCGTGACTCGATCTGGCGTGCTGACCAACCTGGTGCATACGAGAATATCAATTTCGAGTCTCAC
CTCTTCCAAAACGGTTCTATCAGTGCTTGTTATCTCAACACTACCCTCGGAATTCCATGTGAGCAGGGGAATGTT
CCTCCCATTGGCGTCGTTGCTAGGACGGTGGAAGATGTACAAGCAGCGGTGAAGTTTGCTGGCCAGCACAACCTC
CGGCTGGTCGTCAAGAATACAGGGTAAGTCCATTTGAGTATCTTCACTGTAAAGTTGTTGATCCATCGACTTTAT
TTGCCTTTAGACATGATTATCTCGGCCGTAGCTCTGGACGGAACGCTTTCATGATTTGGACACATCATTTGAAGA
ACATAACTTATAACGCCGAATTTATCCCAGAAGGCGGTTCGAAGGACGATGCTATTTTCGGTTCGTCCGATCCGG
CCAGCTCCTCTTTTCTATAACCTAATTGTTCGATGATAAACAGGCTTGACTGTGGGCGCCGGTGTTCAATGGCAC
GAAGCTTACGACGTTGCTGCTCAGAACAACCGCTTCATTGTTGGTGGTATTTCTGCATCAGGGTCCGTTGGAGCT
GCAGGCGGCTGGATCATGGGTGGTGGTCACAGCGCATTCTCTCCAAAATTTGGCCTAGGTGAGTTCGACACAGAT
GCCTTGAAATCAGATGCATTGCTGACCGGGGTTGTGCAGGAGTGGACAACGCTGTCGAGTTCACTATTGTGAAAC
CGAATGGTGATTATGCCGTTGCCAACTCTCACCATAACCAAGACCTCTTCTGGGCGCTGAGAGGCGGTGGTGCAG
GTTCTTGGGGAGTCGTCATTTCTGTGACCTACAAAACACATGATTTACTTCCAATGATTTTGTCCGTTCTTAATG
TCACCTTCCCTACCCTGGATGCTGCGACAAGTGTCGCCACGGAGCTCGTCGGGCTTTTCCCCAAGCTTTCCGACT
TAGGCTGGGGAGGTTATGGAGCTCTTTCAAATACGAGCCTATTAATGGGATTTATGTCCCCAAATGTCTCGTGGG
CAGATGTCAATTCCACCATCCTTCCTTTCTTTGATTTCGCCGTAAATGCTACTCAAGACCCCAATGCTCTCGCTA
CCACTATACCTTTTGCTAATCCTTATGAGCTCATCAATCCCAGCGATGATGCAGGGCTCCAGAACGCCCAGGAGG
TCGGGGGCCTGGTAGAACTTGCATCCCGGCTATTATCCCGCAATGCTGCCGAGCAGAGAGCAGAAGAGACAGCAC
GGCTTCTTTTGAGCTTTGATTTTGTTGGTATCAAGTACGCAAATTTACCTATCACAGAAAATTTTAAATAACGGC
ATCTTATAATAGTTTCGTTGCGGGTGGAGCTGTCGGGCGTGCTGAACCAGATTCCGTTGCTCTTAACCCGGGGTG
GAGAAAAGCTGTAGCTCATGTATACACGTCAGGGAATTGGGAAGAAGGTACTTCGGCTGAAACCATAGAAGAGAT
TCAGCGAGGTGTTGCACGACATGTGAGAGCCTTGGATCCTATTTCTCCGGATTCAACAACCTACATGAACGAGGT
AAAGTATTTCCATGCTAGTGTTTAATGCCAATTTATAACCCTCATCGCAGGCATCGTTATACGAGCCGGACTTCA
AGAAGTCATTCTTTGGCGACCATTACGACAAATTAAGGGCCATTAAACAAATATATGACCCCAGCTCGTTGTTCG
TTGTCGCTGAAGGTGTACATCCGATGAGTGGGATGATACATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail