Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|065390
Gene name
Locationscaffold_3:3104322..3106315
Strand+
Gene length (bp)1993
Transcript length (bp)1632
Coding sequence length (bp)1632
Protein length (aa) 544

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08031 BBE Berberine and berberine like 4.3E-09 488 530

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 24 533 4.0E-73
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 3 541 2.0E-71
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 225 530 2.0E-08

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 23.62 13.31 33.92
Initials Initials knots 26.24 15.07 37.40
Pileal_Stipeal_center Stage I stipe center 26.56 15.29 37.82
Pileal_Stipeal_shell Stage I stipe shell 19.01 10.56 27.47
DIF_stipe_center Stage II stipe center 32.43 18.98 45.87
DIF_stipe_shell Stage II stipe shell 33.59 19.70 47.48
DIF_stipe_skin Stage II stipe skin 29.08 16.92 41.23
DIF_cap_skin Stage II cap skin 19.89 11.11 28.66
DIF_cap_tissue Stage II cap tissue 18.95 10.55 27.35
DIF_gill_tissue Stage II gill tissue 19.04 10.56 27.51
YFB_stipe_center Young fruiting body stipe center 40.54 24.12 56.96
YFB_stipe_shell Young fruiting body stipe shell 34.68 20.44 48.91
YFB_stipe_skin Young fruiting body stipe skin 26.25 15.15 37.36
YFB_cap_skin Young fruiting body cap skin 20.91 11.79 30.03
YFB_cap_tissue Young fruiting body cap tissue 34.45 20.35 48.55
YFB_gill_tissue Young fruiting body gill tissue 21.08 11.88 30.28
YFB_veil Young fruiting body veil 18.46 10.13 26.80

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.600400 no
Casing YFB_stipe_center 0.057350 no
Casing YFB_stipe_shell 0.222035 no
Casing YFB_stipe_skin 0.831905 no
Casing YFB_cap_skin 0.804950 no
Casing YFB_cap_tissue 0.234962 no
Casing YFB_gill_tissue 0.817240 no
Casing YFB_veil 0.528926 no
Casing Initials 0.837806 no
Casing Pileal_Stipeal_center 0.812614 no
Casing Pileal_Stipeal_shell 0.603097 no
Casing DIF_stipe_center 0.353874 no
Casing DIF_stipe_shell 0.288092 no
Casing DIF_stipe_skin 0.603568 no
Casing DIF_cap_skin 0.701728 no
Casing DIF_cap_tissue 0.596294 no
DIF_gill_tissue YFB_stipe_center 0.005671 yes
DIF_gill_tissue YFB_stipe_shell 0.034837 yes
DIF_gill_tissue YFB_stipe_skin 0.355963 no
DIF_gill_tissue YFB_cap_skin 0.862289 no
DIF_gill_tissue YFB_cap_tissue 0.040947 yes
DIF_gill_tissue YFB_gill_tissue 0.843944 no
DIF_gill_tissue YFB_veil 0.960533 no
YFB_stipe_center YFB_stipe_shell 0.699364 no
YFB_stipe_center YFB_stipe_skin 0.135150 no
YFB_stipe_center YFB_cap_skin 0.014956 yes
YFB_stipe_center YFB_cap_tissue 0.684131 no
YFB_stipe_center YFB_gill_tissue 0.015819 yes
YFB_stipe_center YFB_veil 0.003365 yes
YFB_stipe_shell YFB_stipe_skin 0.416361 no
YFB_stipe_shell YFB_cap_skin 0.081058 no
YFB_stipe_shell YFB_cap_tissue 0.990210 no
YFB_stipe_shell YFB_gill_tissue 0.079305 no
YFB_stipe_shell YFB_veil 0.023153 yes
YFB_stipe_skin YFB_cap_skin 0.570663 no
YFB_stipe_skin YFB_cap_tissue 0.440465 no
YFB_stipe_skin YFB_gill_tissue 0.582435 no
YFB_stipe_skin YFB_veil 0.303363 no
YFB_cap_skin YFB_cap_tissue 0.087927 no
YFB_cap_skin YFB_gill_tissue 0.988651 no
YFB_cap_skin YFB_veil 0.801537 no
YFB_cap_tissue YFB_gill_tissue 0.086750 no
YFB_cap_tissue YFB_veil 0.022631 yes
YFB_gill_tissue YFB_veil 0.784153 no
Initials DIF_gill_tissue 0.362232 no
Initials YFB_stipe_center 0.145389 no
Initials YFB_stipe_shell 0.423834 no
Initials YFB_stipe_skin 0.998855 no
Initials YFB_cap_skin 0.572494 no
Initials YFB_cap_tissue 0.437800 no
Initials YFB_gill_tissue 0.585870 no
Initials YFB_veil 0.308631 no
Initials Pileal_Stipeal_center 0.983081 no
Initials Pileal_Stipeal_shell 0.362170 no
Initials DIF_stipe_center 0.593554 no
Initials DIF_stipe_shell 0.507005 no
Initials DIF_stipe_skin 0.832399 no
Initials DIF_cap_skin 0.457845 no
Initials DIF_cap_tissue 0.357201 no
Pileal_Stipeal_center DIF_gill_tissue 0.335056 no
Pileal_Stipeal_center YFB_stipe_center 0.159859 no
Pileal_Stipeal_center YFB_stipe_shell 0.450443 no
Pileal_Stipeal_center YFB_stipe_skin 0.984931 no
Pileal_Stipeal_center YFB_cap_skin 0.541927 no
Pileal_Stipeal_center YFB_cap_tissue 0.463944 no
Pileal_Stipeal_center YFB_gill_tissue 0.554020 no
Pileal_Stipeal_center YFB_veil 0.284249 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.337866 no
Pileal_Stipeal_center DIF_stipe_center 0.618958 no
Pileal_Stipeal_center DIF_stipe_shell 0.533516 no
Pileal_Stipeal_center DIF_stipe_skin 0.858362 no
Pileal_Stipeal_center DIF_cap_skin 0.431335 no
Pileal_Stipeal_center DIF_cap_tissue 0.332527 no
Pileal_Stipeal_shell DIF_gill_tissue 0.997634 no
Pileal_Stipeal_shell YFB_stipe_center 0.004928 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.030372 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.355101 no
Pileal_Stipeal_shell YFB_cap_skin 0.858658 no
Pileal_Stipeal_shell YFB_cap_tissue 0.036228 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.839658 no
Pileal_Stipeal_shell YFB_veil 0.962009 no
Pileal_Stipeal_shell DIF_stipe_center 0.071041 no
Pileal_Stipeal_shell DIF_stipe_shell 0.050706 no
Pileal_Stipeal_shell DIF_stipe_skin 0.181328 no
Pileal_Stipeal_shell DIF_cap_skin 0.941251 no
Pileal_Stipeal_shell DIF_cap_tissue 0.994603 no
DIF_stipe_center DIF_gill_tissue 0.066395 no
DIF_stipe_center YFB_stipe_center 0.539831 no
DIF_stipe_center YFB_stipe_shell 0.898684 no
DIF_stipe_center YFB_stipe_skin 0.581973 no
DIF_stipe_center YFB_cap_skin 0.158357 no
DIF_stipe_center YFB_cap_tissue 0.909190 no
DIF_stipe_center YFB_gill_tissue 0.155303 no
DIF_stipe_center YFB_veil 0.049674 yes
DIF_stipe_center DIF_stipe_shell 0.951182 no
DIF_stipe_center DIF_stipe_skin 0.818520 no
DIF_stipe_center DIF_cap_skin 0.099595 no
DIF_stipe_center DIF_cap_tissue 0.065465 no
DIF_stipe_shell DIF_gill_tissue 0.048834 yes
DIF_stipe_shell YFB_stipe_center 0.629510 no
DIF_stipe_shell YFB_stipe_shell 0.955471 no
DIF_stipe_shell YFB_stipe_skin 0.498596 no
DIF_stipe_shell YFB_cap_skin 0.120676 no
DIF_stipe_shell YFB_cap_tissue 0.964132 no
DIF_stipe_shell YFB_gill_tissue 0.120220 no
DIF_stipe_shell YFB_veil 0.032742 yes
DIF_stipe_shell DIF_stipe_skin 0.740066 no
DIF_stipe_shell DIF_cap_skin 0.076086 no
DIF_stipe_shell DIF_cap_tissue 0.046952 yes
DIF_stipe_skin DIF_gill_tissue 0.172824 no
DIF_stipe_skin YFB_stipe_center 0.294241 no
DIF_stipe_skin YFB_stipe_shell 0.656575 no
DIF_stipe_skin YFB_stipe_skin 0.831196 no
DIF_stipe_skin YFB_cap_skin 0.331349 no
DIF_stipe_skin YFB_cap_tissue 0.673724 no
DIF_stipe_skin YFB_gill_tissue 0.334259 no
DIF_stipe_skin YFB_veil 0.138282 no
DIF_stipe_skin DIF_cap_skin 0.242331 no
DIF_stipe_skin DIF_cap_tissue 0.169576 no
DIF_cap_skin DIF_gill_tissue 0.942209 no
DIF_cap_skin YFB_stipe_center 0.009773 yes
DIF_cap_skin YFB_stipe_shell 0.053358 no
DIF_cap_skin YFB_stipe_skin 0.449002 no
DIF_cap_skin YFB_cap_skin 0.930651 no
DIF_cap_skin YFB_cap_tissue 0.062995 no
DIF_cap_skin YFB_gill_tissue 0.918427 no
DIF_cap_skin YFB_veil 0.894579 no
DIF_cap_skin DIF_cap_tissue 0.936445 no
DIF_cap_tissue DIF_gill_tissue 0.992744 no
DIF_cap_tissue YFB_stipe_center 0.004160 yes
DIF_cap_tissue YFB_stipe_shell 0.032038 yes
DIF_cap_tissue YFB_stipe_skin 0.344404 no
DIF_cap_tissue YFB_cap_skin 0.852172 no
DIF_cap_tissue YFB_cap_tissue 0.035765 yes
DIF_cap_tissue YFB_gill_tissue 0.832156 no
DIF_cap_tissue YFB_veil 0.965089 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|065390
MRLKALLDFVILVSTWSKGDGNCRCLYNEPCWPTKQDFASLSSYLSQPLLRPVPPASACYPIHNPSGNCSDVQSH
RRDSIWRTDQPGAYENINFESHIFQNGSISACYLNTTFGIPCEQGNVPPVGVDARTVEDVQAAVKFAGQHNLRLV
VKNTGSGRNAFMIWTHHLKNITYNAGFIPEGGSRKHAVPGLTVGAGVQWYEAYTAAAQNNRFVVGGISTTGRGVD
NAVEFTIVKPNGDYAVVNSHHNQDLFWALRGGGPGSWGVLISVTYKTHDLFPLIFSTLKVTFPTPDAATSVVTEL
VRLSPILSDLGWGGYGVFSNMSLFLGFPSPNASWGDVKSTILPLFDLAMNASHDPDAVATTTPLANPYELLNPSD
GTESQDDPEVGGLAELGSRLLSRNAAELRPEETARLLLSFDFVEVHFVAGGAVGRVEPDSVALNPGWRKAVALVR
TAGSWEEGTSAKAINGIQQGLAQDVRALDHISPDSATYMNEASLHEPDFKKSFFGNHYDKLKAIKRKYDPRSLFI
VAEGIASDGWDDALTCPR*
Coding >AgabiH97|065390
ATGAGATTGAAGGCTTTGCTTGATTTTGTCATACTCGTGTCTACCTGGTCGAAAGGGGACGGCAACTGCCGCTGT
CTCTATAACGAACCTTGTTGGCCCACCAAACAAGACTTTGCTTCTCTCTCCTCCTATCTGTCCCAGCCCCTCCTC
CGTCCCGTACCTCCCGCTTCGGCTTGTTATCCTATTCACAATCCGTCTGGCAACTGTTCCGACGTGCAGAGCCAT
CGGCGTGACTCGATCTGGCGTACCGACCAACCTGGTGCATATGAAAATATCAATTTCGAATCTCACATATTCCAG
AATGGTTCTATTAGTGCCTGTTACCTCAACACTACTTTCGGAATTCCATGTGAACAGGGAAATGTTCCTCCAGTT
GGCGTCGATGCTAGGACGGTGGAAGATGTACAAGCAGCGGTGAAGTTTGCTGGCCAGCACAACCTCCGGCTCGTC
GTCAAGAATACAGGTTCTGGACGGAACGCTTTCATGATTTGGACGCATCATCTCAAGAACATAACCTATAACGCC
GGATTTATCCCAGAAGGCGGTTCGAGAAAACATGCTGTGCCTGGCTTGACTGTGGGCGCTGGTGTTCAATGGTAT
GAAGCCTACACTGCTGCTGCGCAGAACAACCGCTTTGTCGTTGGCGGTATATCTACAACAGGGCGAGGAGTGGAC
AACGCCGTCGAGTTTACTATTGTCAAACCGAATGGTGATTATGCCGTAGTCAACTCTCACCATAATCAAGACCTC
TTCTGGGCGCTGAGAGGCGGCGGCCCAGGTTCTTGGGGAGTCCTCATCTCTGTGACTTACAAAACGCACGATTTA
TTCCCACTTATCTTCTCTACTCTTAAAGTCACCTTCCCTACTCCGGATGCTGCGACTAGCGTCGTCACGGAGCTC
GTCAGACTATCTCCCATACTTTCAGACTTGGGCTGGGGAGGTTACGGAGTATTTTCAAATATGAGCCTCTTCCTG
GGATTTCCGTCCCCAAATGCCTCGTGGGGAGATGTCAAATCTACCATTCTTCCTCTCTTTGACCTCGCTATGAAT
GCTTCCCACGACCCCGATGCTGTCGCTACCACCACACCTCTTGCTAACCCTTATGAGCTCCTGAATCCCAGTGAC
GGCACTGAAAGCCAGGATGATCCAGAGGTTGGGGGACTGGCCGAACTCGGGTCCCGGTTATTATCCCGCAACGCT
GCCGAGCTGAGACCGGAGGAGACAGCACGGCTTCTTCTGAGCTTTGATTTTGTTGAAGTTCATTTCGTCGCGGGT
GGAGCTGTTGGGCGCGTTGAACCCGATTCCGTTGCTCTTAACCCAGGGTGGAGAAAAGCTGTAGCCCTTGTACGT
ACGGCAGGAAGTTGGGAAGAAGGAACTTCAGCCAAAGCCATCAACGGGATTCAGCAAGGTCTTGCACAAGATGTT
AGAGCCTTGGATCACATATCTCCAGACTCAGCAACATACATGAATGAGGCATCGTTGCATGAGCCGGACTTCAAG
AAGTCATTCTTTGGTAACCATTATGACAAATTAAAGGCCATTAAACGAAAGTATGATCCCCGCTCGCTATTTATT
GTCGCTGAAGGTATAGCATCTGATGGATGGGATGATGCGTTGACGTGCCCCCGATGA
Transcript >AgabiH97|065390
ATGAGATTGAAGGCTTTGCTTGATTTTGTCATACTCGTGTCTACCTGGTCGAAAGGGGACGGCAACTGCCGCTGT
CTCTATAACGAACCTTGTTGGCCCACCAAACAAGACTTTGCTTCTCTCTCCTCCTATCTGTCCCAGCCCCTCCTC
CGTCCCGTACCTCCCGCTTCGGCTTGTTATCCTATTCACAATCCGTCTGGCAACTGTTCCGACGTGCAGAGCCAT
CGGCGTGACTCGATCTGGCGTACCGACCAACCTGGTGCATATGAAAATATCAATTTCGAATCTCACATATTCCAG
AATGGTTCTATTAGTGCCTGTTACCTCAACACTACTTTCGGAATTCCATGTGAACAGGGAAATGTTCCTCCAGTT
GGCGTCGATGCTAGGACGGTGGAAGATGTACAAGCAGCGGTGAAGTTTGCTGGCCAGCACAACCTCCGGCTCGTC
GTCAAGAATACAGGTTCTGGACGGAACGCTTTCATGATTTGGACGCATCATCTCAAGAACATAACCTATAACGCC
GGATTTATCCCAGAAGGCGGTTCGAGAAAACATGCTGTGCCTGGCTTGACTGTGGGCGCTGGTGTTCAATGGTAT
GAAGCCTACACTGCTGCTGCGCAGAACAACCGCTTTGTCGTTGGCGGTATATCTACAACAGGGCGAGGAGTGGAC
AACGCCGTCGAGTTTACTATTGTCAAACCGAATGGTGATTATGCCGTAGTCAACTCTCACCATAATCAAGACCTC
TTCTGGGCGCTGAGAGGCGGCGGCCCAGGTTCTTGGGGAGTCCTCATCTCTGTGACTTACAAAACGCACGATTTA
TTCCCACTTATCTTCTCTACTCTTAAAGTCACCTTCCCTACTCCGGATGCTGCGACTAGCGTCGTCACGGAGCTC
GTCAGACTATCTCCCATACTTTCAGACTTGGGCTGGGGAGGTTACGGAGTATTTTCAAATATGAGCCTCTTCCTG
GGATTTCCGTCCCCAAATGCCTCGTGGGGAGATGTCAAATCTACCATTCTTCCTCTCTTTGACCTCGCTATGAAT
GCTTCCCACGACCCCGATGCTGTCGCTACCACCACACCTCTTGCTAACCCTTATGAGCTCCTGAATCCCAGTGAC
GGCACTGAAAGCCAGGATGATCCAGAGGTTGGGGGACTGGCCGAACTCGGGTCCCGGTTATTATCCCGCAACGCT
GCCGAGCTGAGACCGGAGGAGACAGCACGGCTTCTTCTGAGCTTTGATTTTGTTGAAGTTCATTTCGTCGCGGGT
GGAGCTGTTGGGCGCGTTGAACCCGATTCCGTTGCTCTTAACCCAGGGTGGAGAAAAGCTGTAGCCCTTGTACGT
ACGGCAGGAAGTTGGGAAGAAGGAACTTCAGCCAAAGCCATCAACGGGATTCAGCAAGGTCTTGCACAAGATGTT
AGAGCCTTGGATCACATATCTCCAGACTCAGCAACATACATGAATGAGGCATCGTTGCATGAGCCGGACTTCAAG
AAGTCATTCTTTGGTAACCATTATGACAAATTAAAGGCCATTAAACGAAAGTATGATCCCCGCTCGCTATTTATT
GTCGCTGAAGGTATAGCATCTGATGGATGGGATGATGCGTTGACGTGCCCCCGATGA
Gene >AgabiH97|065390
ATGAGATTGAAGGCTTTGCTTGATTTTGTCATACTCGTGTCTACCTGGTCGAAAGGGGACGGCAACTGCCGCTGT
CTCTATAACGAACCTTGTTGGCCCACCAAACAAGACTTTGCTTCTCTCTCCTCCTATCTGTCCCAGCCCCTCCTC
CGTCCCGTACCTCCCGCTTCGGCTTGTTATCCTATTCACAATCCGTCTGGCAACTGTTCCGACGTGCAGAGCCAT
CGGCGTGACTCGATCTGGCGTACCGACCAACCTGGTGCATATGAAAATATCAATTTCGAATCTCACATATTCCAG
AATGGTTCTATTAGTGCCTGTTACCTCAACACTACTTTCGGAATTCCATGTGAACAGGGAAATGTTCCTCCAGTT
GGCGTCGATGCTAGGACGGTGGAAGATGTACAAGCAGCGGTGAAGTTTGCTGGCCAGCACAACCTCCGGCTCGTC
GTCAAGAATACAGGGTAAGCTCATTTGGAGTATCTTCACTAAAAGTTGTTGACCCATAGACTTTATAAATCCACG
GACATGATTATCTCGGCCGTAGTTCTGGACGGAACGCTTTCATGATTTGGACGCATCATCTCAAGAACATAACCT
ATAACGCCGGATTTATCCCAGAAGGCGGTTCGAGAAAACATGCTGTGCCTGGTTCGTCTAAGACTAGCTCTCCTT
AGCCCTAACGGTTGACCGTTCGACGATAAACAGGCTTGACTGTGGGCGCTGGTGTTCAATGGTATGAAGCCTACA
CTGCTGCTGCGCAGAACAACCGCTTTGTCGTTGGCGGTATATCTACAACAGGGTCTAATGGAGCTGCAGGCGGTT
GGATCATGGGTGGTGGTCACAGCGTATTTTCTCCAAAATTTGGCCTAGGCGAGGTCAGCACAAATGCCTTACTTA
GATGCATCGCTGACTGGGGTTGTGCAGGAGTGGACAACGCCGTCGAGTTTACTATTGTCAAACCGAATGGTGATT
ATGCCGTAGTCAACTCTCACCATAATCAAGACCTCTTCTGGGCGCTGAGAGGCGGCGGCCCAGGTTCTTGGGGAG
TCCTCATCTCTGTGACTTACAAAACGCACGATTTATTCCCACTTATCTTCTCTACTCTTAAAGTCACCTTCCCTA
CTCCGGATGCTGCGACTAGCGTCGTCACGGAGCTCGTCAGACTATCTCCCATACTTTCAGACTTGGGCTGGGGAG
GTTACGGAGTATTTTCAAATATGAGCCTCTTCCTGGGATTTCCGTCCCCAAATGCCTCGTGGGGAGATGTCAAAT
CTACCATTCTTCCTCTCTTTGACCTCGCTATGAATGCTTCCCACGACCCCGATGCTGTCGCTACCACCACACCTC
TTGCTAACCCTTATGAGCTCCTGAATCCCAGTGACGGCACTGAAAGCCAGGATGATCCAGAGGTTGGGGGACTGG
CCGAACTCGGGTCCCGGTTATTATCCCGCAACGCTGCCGAGCTGAGACCGGAGGAGACAGCACGGCTTCTTCTGA
GCTTTGATTTTGTTGAAGTTCAGTACGTAAAATTCATCCTAGTACAGAAATATCTAACTGACTTGTCATAGTTTC
GTCGCGGGTGGAGCTGTTGGGCGCGTTGAACCCGATTCCGTTGCTCTTAACCCAGGGTGGAGAAAAGCTGTAGCC
CTTGTACGTACGGCAGGAAGTTGGGAAGAAGGAACTTCAGCCAAAGCCATCAACGGGATTCAGCAAGGTCTTGCA
CAAGATGTTAGAGCCTTGGATCACATATCTCCAGACTCAGCAACATACATGAATGAGGTAGAGTGTTTTTCCTGT
AGTAGTTAACGACGGTTTATAATTCTCATCACAGGCATCGTTGCATGAGCCGGACTTCAAGAAGTCATTCTTTGG
TAACCATTATGACAAATTAAAGGCCATTAAACGAAAGTATGATCCCCGCTCGCTATTTATTGTCGCTGAAGGTAT
AGCATCTGATGGATGGGATGATGCGTTGACGTGCCCCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail