Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|065390
Gene name
Locationscaffold_3:3104322..3106315
Strand+
Gene length (bp)1993
Transcript length (bp)1632
Coding sequence length (bp)1632
Protein length (aa) 544

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08031 BBE Berberine and berberine like 4.3E-09 488 530

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 24 533 4.0E-73
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 3 541 2.0E-71
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 225 530 2.0E-08

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|065390
MRLKALLDFVILVSTWSKGDGNCRCLYNEPCWPTKQDFASLSSYLSQPLLRPVPPASACYPIHNPSGNCSDVQSH
RRDSIWRTDQPGAYENINFESHIFQNGSISACYLNTTFGIPCEQGNVPPVGVDARTVEDVQAAVKFAGQHNLRLV
VKNTGSGRNAFMIWTHHLKNITYNAGFIPEGGSRKHAVPGLTVGAGVQWYEAYTAAAQNNRFVVGGISTTGRGVD
NAVEFTIVKPNGDYAVVNSHHNQDLFWALRGGGPGSWGVLISVTYKTHDLFPLIFSTLKVTFPTPDAATSVVTEL
VRLSPILSDLGWGGYGVFSNMSLFLGFPSPNASWGDVKSTILPLFDLAMNASHDPDAVATTTPLANPYELLNPSD
GTESQDDPEVGGLAELGSRLLSRNAAELRPEETARLLLSFDFVEVHFVAGGAVGRVEPDSVALNPGWRKAVALVR
TAGSWEEGTSAKAINGIQQGLAQDVRALDHISPDSATYMNEASLHEPDFKKSFFGNHYDKLKAIKRKYDPRSLFI
VAEGIASDGWDDALTCPR*
Coding >AgabiH97|065390
ATGAGATTGAAGGCTTTGCTTGATTTTGTCATACTCGTGTCTACCTGGTCGAAAGGGGACGGCAACTGCCGCTGT
CTCTATAACGAACCTTGTTGGCCCACCAAACAAGACTTTGCTTCTCTCTCCTCCTATCTGTCCCAGCCCCTCCTC
CGTCCCGTACCTCCCGCTTCGGCTTGTTATCCTATTCACAATCCGTCTGGCAACTGTTCCGACGTGCAGAGCCAT
CGGCGTGACTCGATCTGGCGTACCGACCAACCTGGTGCATATGAAAATATCAATTTCGAATCTCACATATTCCAG
AATGGTTCTATTAGTGCCTGTTACCTCAACACTACTTTCGGAATTCCATGTGAACAGGGAAATGTTCCTCCAGTT
GGCGTCGATGCTAGGACGGTGGAAGATGTACAAGCAGCGGTGAAGTTTGCTGGCCAGCACAACCTCCGGCTCGTC
GTCAAGAATACAGGTTCTGGACGGAACGCTTTCATGATTTGGACGCATCATCTCAAGAACATAACCTATAACGCC
GGATTTATCCCAGAAGGCGGTTCGAGAAAACATGCTGTGCCTGGCTTGACTGTGGGCGCTGGTGTTCAATGGTAT
GAAGCCTACACTGCTGCTGCGCAGAACAACCGCTTTGTCGTTGGCGGTATATCTACAACAGGGCGAGGAGTGGAC
AACGCCGTCGAGTTTACTATTGTCAAACCGAATGGTGATTATGCCGTAGTCAACTCTCACCATAATCAAGACCTC
TTCTGGGCGCTGAGAGGCGGCGGCCCAGGTTCTTGGGGAGTCCTCATCTCTGTGACTTACAAAACGCACGATTTA
TTCCCACTTATCTTCTCTACTCTTAAAGTCACCTTCCCTACTCCGGATGCTGCGACTAGCGTCGTCACGGAGCTC
GTCAGACTATCTCCCATACTTTCAGACTTGGGCTGGGGAGGTTACGGAGTATTTTCAAATATGAGCCTCTTCCTG
GGATTTCCGTCCCCAAATGCCTCGTGGGGAGATGTCAAATCTACCATTCTTCCTCTCTTTGACCTCGCTATGAAT
GCTTCCCACGACCCCGATGCTGTCGCTACCACCACACCTCTTGCTAACCCTTATGAGCTCCTGAATCCCAGTGAC
GGCACTGAAAGCCAGGATGATCCAGAGGTTGGGGGACTGGCCGAACTCGGGTCCCGGTTATTATCCCGCAACGCT
GCCGAGCTGAGACCGGAGGAGACAGCACGGCTTCTTCTGAGCTTTGATTTTGTTGAAGTTCATTTCGTCGCGGGT
GGAGCTGTTGGGCGCGTTGAACCCGATTCCGTTGCTCTTAACCCAGGGTGGAGAAAAGCTGTAGCCCTTGTACGT
ACGGCAGGAAGTTGGGAAGAAGGAACTTCAGCCAAAGCCATCAACGGGATTCAGCAAGGTCTTGCACAAGATGTT
AGAGCCTTGGATCACATATCTCCAGACTCAGCAACATACATGAATGAGGCATCGTTGCATGAGCCGGACTTCAAG
AAGTCATTCTTTGGTAACCATTATGACAAATTAAAGGCCATTAAACGAAAGTATGATCCCCGCTCGCTATTTATT
GTCGCTGAAGGTATAGCATCTGATGGATGGGATGATGCGTTGACGTGCCCCCGATGA
Transcript >AgabiH97|065390
ATGAGATTGAAGGCTTTGCTTGATTTTGTCATACTCGTGTCTACCTGGTCGAAAGGGGACGGCAACTGCCGCTGT
CTCTATAACGAACCTTGTTGGCCCACCAAACAAGACTTTGCTTCTCTCTCCTCCTATCTGTCCCAGCCCCTCCTC
CGTCCCGTACCTCCCGCTTCGGCTTGTTATCCTATTCACAATCCGTCTGGCAACTGTTCCGACGTGCAGAGCCAT
CGGCGTGACTCGATCTGGCGTACCGACCAACCTGGTGCATATGAAAATATCAATTTCGAATCTCACATATTCCAG
AATGGTTCTATTAGTGCCTGTTACCTCAACACTACTTTCGGAATTCCATGTGAACAGGGAAATGTTCCTCCAGTT
GGCGTCGATGCTAGGACGGTGGAAGATGTACAAGCAGCGGTGAAGTTTGCTGGCCAGCACAACCTCCGGCTCGTC
GTCAAGAATACAGGTTCTGGACGGAACGCTTTCATGATTTGGACGCATCATCTCAAGAACATAACCTATAACGCC
GGATTTATCCCAGAAGGCGGTTCGAGAAAACATGCTGTGCCTGGCTTGACTGTGGGCGCTGGTGTTCAATGGTAT
GAAGCCTACACTGCTGCTGCGCAGAACAACCGCTTTGTCGTTGGCGGTATATCTACAACAGGGCGAGGAGTGGAC
AACGCCGTCGAGTTTACTATTGTCAAACCGAATGGTGATTATGCCGTAGTCAACTCTCACCATAATCAAGACCTC
TTCTGGGCGCTGAGAGGCGGCGGCCCAGGTTCTTGGGGAGTCCTCATCTCTGTGACTTACAAAACGCACGATTTA
TTCCCACTTATCTTCTCTACTCTTAAAGTCACCTTCCCTACTCCGGATGCTGCGACTAGCGTCGTCACGGAGCTC
GTCAGACTATCTCCCATACTTTCAGACTTGGGCTGGGGAGGTTACGGAGTATTTTCAAATATGAGCCTCTTCCTG
GGATTTCCGTCCCCAAATGCCTCGTGGGGAGATGTCAAATCTACCATTCTTCCTCTCTTTGACCTCGCTATGAAT
GCTTCCCACGACCCCGATGCTGTCGCTACCACCACACCTCTTGCTAACCCTTATGAGCTCCTGAATCCCAGTGAC
GGCACTGAAAGCCAGGATGATCCAGAGGTTGGGGGACTGGCCGAACTCGGGTCCCGGTTATTATCCCGCAACGCT
GCCGAGCTGAGACCGGAGGAGACAGCACGGCTTCTTCTGAGCTTTGATTTTGTTGAAGTTCATTTCGTCGCGGGT
GGAGCTGTTGGGCGCGTTGAACCCGATTCCGTTGCTCTTAACCCAGGGTGGAGAAAAGCTGTAGCCCTTGTACGT
ACGGCAGGAAGTTGGGAAGAAGGAACTTCAGCCAAAGCCATCAACGGGATTCAGCAAGGTCTTGCACAAGATGTT
AGAGCCTTGGATCACATATCTCCAGACTCAGCAACATACATGAATGAGGCATCGTTGCATGAGCCGGACTTCAAG
AAGTCATTCTTTGGTAACCATTATGACAAATTAAAGGCCATTAAACGAAAGTATGATCCCCGCTCGCTATTTATT
GTCGCTGAAGGTATAGCATCTGATGGATGGGATGATGCGTTGACGTGCCCCCGATGA
Gene >AgabiH97|065390
ATGAGATTGAAGGCTTTGCTTGATTTTGTCATACTCGTGTCTACCTGGTCGAAAGGGGACGGCAACTGCCGCTGT
CTCTATAACGAACCTTGTTGGCCCACCAAACAAGACTTTGCTTCTCTCTCCTCCTATCTGTCCCAGCCCCTCCTC
CGTCCCGTACCTCCCGCTTCGGCTTGTTATCCTATTCACAATCCGTCTGGCAACTGTTCCGACGTGCAGAGCCAT
CGGCGTGACTCGATCTGGCGTACCGACCAACCTGGTGCATATGAAAATATCAATTTCGAATCTCACATATTCCAG
AATGGTTCTATTAGTGCCTGTTACCTCAACACTACTTTCGGAATTCCATGTGAACAGGGAAATGTTCCTCCAGTT
GGCGTCGATGCTAGGACGGTGGAAGATGTACAAGCAGCGGTGAAGTTTGCTGGCCAGCACAACCTCCGGCTCGTC
GTCAAGAATACAGGGTAAGCTCATTTGGAGTATCTTCACTAAAAGTTGTTGACCCATAGACTTTATAAATCCACG
GACATGATTATCTCGGCCGTAGTTCTGGACGGAACGCTTTCATGATTTGGACGCATCATCTCAAGAACATAACCT
ATAACGCCGGATTTATCCCAGAAGGCGGTTCGAGAAAACATGCTGTGCCTGGTTCGTCTAAGACTAGCTCTCCTT
AGCCCTAACGGTTGACCGTTCGACGATAAACAGGCTTGACTGTGGGCGCTGGTGTTCAATGGTATGAAGCCTACA
CTGCTGCTGCGCAGAACAACCGCTTTGTCGTTGGCGGTATATCTACAACAGGGTCTAATGGAGCTGCAGGCGGTT
GGATCATGGGTGGTGGTCACAGCGTATTTTCTCCAAAATTTGGCCTAGGCGAGGTCAGCACAAATGCCTTACTTA
GATGCATCGCTGACTGGGGTTGTGCAGGAGTGGACAACGCCGTCGAGTTTACTATTGTCAAACCGAATGGTGATT
ATGCCGTAGTCAACTCTCACCATAATCAAGACCTCTTCTGGGCGCTGAGAGGCGGCGGCCCAGGTTCTTGGGGAG
TCCTCATCTCTGTGACTTACAAAACGCACGATTTATTCCCACTTATCTTCTCTACTCTTAAAGTCACCTTCCCTA
CTCCGGATGCTGCGACTAGCGTCGTCACGGAGCTCGTCAGACTATCTCCCATACTTTCAGACTTGGGCTGGGGAG
GTTACGGAGTATTTTCAAATATGAGCCTCTTCCTGGGATTTCCGTCCCCAAATGCCTCGTGGGGAGATGTCAAAT
CTACCATTCTTCCTCTCTTTGACCTCGCTATGAATGCTTCCCACGACCCCGATGCTGTCGCTACCACCACACCTC
TTGCTAACCCTTATGAGCTCCTGAATCCCAGTGACGGCACTGAAAGCCAGGATGATCCAGAGGTTGGGGGACTGG
CCGAACTCGGGTCCCGGTTATTATCCCGCAACGCTGCCGAGCTGAGACCGGAGGAGACAGCACGGCTTCTTCTGA
GCTTTGATTTTGTTGAAGTTCAGTACGTAAAATTCATCCTAGTACAGAAATATCTAACTGACTTGTCATAGTTTC
GTCGCGGGTGGAGCTGTTGGGCGCGTTGAACCCGATTCCGTTGCTCTTAACCCAGGGTGGAGAAAAGCTGTAGCC
CTTGTACGTACGGCAGGAAGTTGGGAAGAAGGAACTTCAGCCAAAGCCATCAACGGGATTCAGCAAGGTCTTGCA
CAAGATGTTAGAGCCTTGGATCACATATCTCCAGACTCAGCAACATACATGAATGAGGTAGAGTGTTTTTCCTGT
AGTAGTTAACGACGGTTTATAATTCTCATCACAGGCATCGTTGCATGAGCCGGACTTCAAGAAGTCATTCTTTGG
TAACCATTATGACAAATTAAAGGCCATTAAACGAAAGTATGATCCCCGCTCGCTATTTATTGTCGCTGAAGGTAT
AGCATCTGATGGATGGGATGATGCGTTGACGTGCCCCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail