© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|065380 |
| Gene name | |
| Location | scaffold_3:3102752..3103342 |
| Strand | - |
| Gene length (bp) | 590 |
| Transcript length (bp) | 396 |
| Coding sequence length (bp) | 396 |
| Protein length (aa) | 132 |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Extracellular | Signal peptide | 0.1339 | 0.0697 | 0.9244 | 0.0742 | 0.0724 | 0.0104 | 0.1373 | 0.2002 | 0.0875 | 0.0014 |
| SignalP signal predicted | Location | Score |
|---|---|---|
| Yes | 1 - 19 | 0.999726 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 85.96 | 34.23 | 137.68 |
| Initials | Initials knots | 5.62 | 1.39 | 9.85 |
| Pileal_Stipeal_center | Stage I stipe center | 62.91 | 26.38 | 99.43 |
| Pileal_Stipeal_shell | Stage I stipe shell | 1.76 | 0.00 | 3.67 |
| DIF_stipe_center | Stage II stipe center | 26.02 | 10.55 | 41.49 |
| DIF_stipe_shell | Stage II stipe shell | 118.35 | 56.36 | 180.34 |
| DIF_stipe_skin | Stage II stipe skin | 62.61 | 29.32 | 95.90 |
| DIF_cap_skin | Stage II cap skin | 2.57 | 0.17 | 4.98 |
| DIF_cap_tissue | Stage II cap tissue | 3.20 | 0.41 | 5.98 |
| DIF_gill_tissue | Stage II gill tissue | 3.02 | 0.31 | 5.72 |
| YFB_stipe_center | Young fruiting body stipe center | 174.00 | 97.60 | 250.39 |
| YFB_stipe_shell | Young fruiting body stipe shell | 106.69 | 55.39 | 157.98 |
| YFB_stipe_skin | Young fruiting body stipe skin | 26.31 | 10.29 | 42.33 |
| YFB_cap_skin | Young fruiting body cap skin | 3.50 | 0.50 | 6.50 |
| YFB_cap_tissue | Young fruiting body cap tissue | 23.37 | 9.00 | 37.74 |
| YFB_gill_tissue | Young fruiting body gill tissue | 2.75 | 0.19 | 5.30 |
| YFB_veil | Young fruiting body veil | 2.25 | 0.03 | 4.47 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.000613 | yes |
| Casing | YFB_stipe_center | 0.064705 | no |
| Casing | YFB_stipe_shell | 0.701001 | no |
| Casing | YFB_stipe_skin | 0.002084 | yes |
| Casing | YFB_cap_skin | 0.000613 | yes |
| Casing | YFB_cap_tissue | 0.001140 | yes |
| Casing | YFB_gill_tissue | 0.000613 | yes |
| Casing | YFB_veil | 0.000613 | yes |
| Casing | Initials | 0.000613 | yes |
| Casing | Pileal_Stipeal_center | 0.571988 | no |
| Casing | Pileal_Stipeal_shell | 0.000613 | yes |
| Casing | DIF_stipe_center | 0.002084 | yes |
| Casing | DIF_stipe_shell | 0.531678 | no |
| Casing | DIF_stipe_skin | 0.534619 | no |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.891173 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_gill_tissue | 0.940527 | no |
| DIF_gill_tissue | YFB_veil | 0.787566 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.135743 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.000613 | yes |
| YFB_stipe_center | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_veil | 0.000613 | yes |
| YFB_stipe_shell | YFB_stipe_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_veil | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.876171 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.001140 | yes |
| YFB_stipe_skin | YFB_veil | 0.000613 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.001140 | yes |
| YFB_cap_skin | YFB_gill_tissue | 0.808077 | no |
| YFB_cap_skin | YFB_veil | 0.616384 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.001625 | yes |
| YFB_cap_tissue | YFB_veil | 0.000613 | yes |
| YFB_gill_tissue | YFB_veil | 0.866332 | no |
| Initials | DIF_gill_tissue | 0.363051 | no |
| Initials | YFB_stipe_center | 0.000613 | yes |
| Initials | YFB_stipe_shell | 0.000613 | yes |
| Initials | YFB_stipe_skin | 0.001140 | yes |
| Initials | YFB_cap_skin | 0.492711 | no |
| Initials | YFB_cap_tissue | 0.001140 | yes |
| Initials | YFB_gill_tissue | 0.272943 | no |
| Initials | YFB_veil | 0.177942 | no |
| Initials | Pileal_Stipeal_center | 0.000613 | yes |
| Initials | Pileal_Stipeal_shell | 0.117172 | no |
| Initials | DIF_stipe_center | 0.001140 | yes |
| Initials | DIF_stipe_shell | 0.000613 | yes |
| Initials | DIF_stipe_skin | 0.000613 | yes |
| Initials | DIF_cap_skin | 0.224134 | no |
| Initials | DIF_cap_tissue | 0.395351 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_stipe_center | 0.002525 | yes |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.174239 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.024698 | yes |
| Pileal_Stipeal_center | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.006032 | yes |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_veil | 0.000613 | yes |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_stipe_center | 0.018066 | yes |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.099273 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.994680 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.574890 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.002084 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.419197 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.002951 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.657691 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.848233 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.002084 | yes |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.720198 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.495767 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_stipe_center | 0.000613 | yes |
| DIF_stipe_center | YFB_stipe_shell | 0.000613 | yes |
| DIF_stipe_center | YFB_stipe_skin | 0.988715 | no |
| DIF_stipe_center | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.887372 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.001140 | yes |
| DIF_stipe_center | YFB_veil | 0.000613 | yes |
| DIF_stipe_center | DIF_stipe_shell | 0.000613 | yes |
| DIF_stipe_center | DIF_stipe_skin | 0.016104 | yes |
| DIF_stipe_center | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_stipe_center | 0.298796 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.864534 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.000613 | yes |
| DIF_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_veil | 0.000613 | yes |
| DIF_stipe_shell | DIF_stipe_skin | 0.063954 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_shell | 0.134284 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.021056 | yes |
| DIF_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.004548 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_veil | 0.000613 | yes |
| DIF_stipe_skin | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.000613 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.891772 | no |
| DIF_cap_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.739242 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_cap_skin | YFB_gill_tissue | 0.960307 | no |
| DIF_cap_skin | YFB_veil | 0.914224 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.835355 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.962462 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.936885 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_cap_tissue | YFB_gill_tissue | 0.893425 | no |
| DIF_cap_tissue | YFB_veil | 0.720930 | no |
| Orthofinder run ID | 1 |
| Orthogroup | 12534 |
| Change Orthofinder run |
| Species | Protein ID |
|---|---|
| Agaricus bisporus var bisporus H39 | AgabiH39|065380 |
| Agaricus bisporus var bisporus H97 | AgabiH97|065380 (this protein) |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|065380 MFKSTLIALALFMSLGADAYVCSCGDRNYSNGDIFGAVNKGYSIDQAANQPDGKFPHRYLPATSIEYPWCGDGHY AEYPLQQVPPGPYESGDPGSDRAIYLVGRRRTFCGCMTLAKNSGDTEDLVLCENDG* |
| Coding | >AgabiH97|065380 ATGTTCAAATCGACATTGATTGCGCTCGCCTTGTTCATGTCCTTGGGCGCAGACGCCTACGTTTGTTCCTGTGGT GATAGAAACTACAGTAATGGCGACATTTTTGGTGCGGTTAACAAAGGATATAGCATAGACCAAGCTGCCAATCAA CCCGATGGAAAATTTCCCCACAGGTATCTCCCCGCAACGTCCATTGAATACCCTTGGTGTGGGGATGGTCATTAC GCCGAATATCCTCTCCAACAAGTACCACCAGGTCCATATGAATCTGGGGACCCTGGGTCAGATCGCGCGATTTAC TTGGTCGGCAGGAGAAGAACATTTTGTGGCTGTATGACTCTCGCTAAAAACTCTGGGGATACTGAAGATCTTGTA CTCTGCGAGAATGATGGTTAA |
| Transcript | >AgabiH97|065380 ATGTTCAAATCGACATTGATTGCGCTCGCCTTGTTCATGTCCTTGGGCGCAGACGCCTACGTTTGTTCCTGTGGT GATAGAAACTACAGTAATGGCGACATTTTTGGTGCGGTTAACAAAGGATATAGCATAGACCAAGCTGCCAATCAA CCCGATGGAAAATTTCCCCACAGGTATCTCCCCGCAACGTCCATTGAATACCCTTGGTGTGGGGATGGTCATTAC GCCGAATATCCTCTCCAACAAGTACCACCAGGTCCATATGAATCTGGGGACCCTGGGTCAGATCGCGCGATTTAC TTGGTCGGCAGGAGAAGAACATTTTGTGGCTGTATGACTCTCGCTAAAAACTCTGGGGATACTGAAGATCTTGTA CTCTGCGAGAATGATGGTTAA |
| Gene | >AgabiH97|065380 ATGTTCAAATCGACATTGATTGCGCTCGCCTTGTTCATGTCCTTGGGCGCAGACGCCTACGTTTGTTCCTGTGGT GGTGGGTCTAATTCAAATCCCTCGACATGATGTGGCAGTGGCATTTCTCTTTAAGGCTGACTGTACAAATTGCCT GTCGATCCAGATAGAAACTACAGTAATGGCGACATTTTTGGTGCGGTTAACAAAGGATATAGCATAGACCAAGCT GCCAATCAACCCGAGTGAGCCTAGAAATCACCAGGATATAAACCGTTTCCGCTAACACGATGAAAAGTGGAAAAT TTCCCCACAGGTATCTCCCCGCAACGTCCATTGAATACCCTTGGTGTGGGGATGGTCATTACGCCGAATATCCTC TCCAACAAGTACCACCAGGTCCATATGAATCTGGGGACCCTGGGTCAGATCGCGCGATTTACTTGGTCGGCAGGA GAAGAACATTTTGTGGTCCGTTGCTTTAATTATGATTGACTACTCTGATGATGATCAAAATTCACATCCCAGGCT GTATGACTCTCGCTAAAAACTCTGGGGATACTGAAGATCTTGTACTCTGCGAGAATGATGGTTAA |