Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|065230
Gene name
Locationscaffold_3:3059161..3059888
Strand+
Gene length (bp)727
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 2.0E-08 69 132

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.0841 0.0557 0.8261 0.4433 0.0933 0.0025 0.2071 0.1377 0.1797 0.0033

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999784

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 199.59 107.20 291.97
Initials Initials knots 56.80 29.22 84.38
Pileal_Stipeal_center Stage I stipe center 180.64 107.91 253.36
Pileal_Stipeal_shell Stage I stipe shell 112.75 65.17 160.33
DIF_stipe_center Stage II stipe center 191.08 114.62 267.54
DIF_stipe_shell Stage II stipe shell 179.57 103.77 255.37
DIF_stipe_skin Stage II stipe skin 156.88 93.48 220.27
DIF_cap_skin Stage II cap skin 83.43 47.23 119.63
DIF_cap_tissue Stage II cap tissue 116.41 67.15 165.66
DIF_gill_tissue Stage II gill tissue 183.57 110.02 257.13
YFB_stipe_center Young fruiting body stipe center 300.16 181.40 418.93
YFB_stipe_shell Young fruiting body stipe shell 226.14 135.99 316.29
YFB_stipe_skin Young fruiting body stipe skin 155.26 90.33 220.19
YFB_cap_skin Young fruiting body cap skin 34.59 17.51 51.67
YFB_cap_tissue Young fruiting body cap tissue 146.59 82.89 210.29
YFB_gill_tissue Young fruiting body gill tissue 87.45 46.31 128.59
YFB_veil Young fruiting body veil 145.94 85.91 205.98

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.875651 no
Casing YFB_stipe_center 0.211921 no
Casing YFB_stipe_shell 0.794790 no
Casing YFB_stipe_skin 0.533104 no
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.429397 no
Casing YFB_gill_tissue 0.008121 yes
Casing YFB_veil 0.398445 no
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.846859 no
Casing Pileal_Stipeal_shell 0.063183 no
Casing DIF_stipe_center 0.940394 no
Casing DIF_stipe_shell 0.838159 no
Casing DIF_stipe_skin 0.543719 no
Casing DIF_cap_skin 0.001625 yes
Casing DIF_cap_tissue 0.091330 no
DIF_gill_tissue YFB_stipe_center 0.068081 no
DIF_gill_tissue YFB_stipe_shell 0.563533 no
DIF_gill_tissue YFB_stipe_skin 0.688462 no
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.556131 no
DIF_gill_tissue YFB_gill_tissue 0.013186 yes
DIF_gill_tissue YFB_veil 0.527932 no
YFB_stipe_center YFB_stipe_shell 0.375995 no
YFB_stipe_center YFB_stipe_skin 0.014956 yes
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.010728 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.006032 yes
YFB_stipe_shell YFB_stipe_skin 0.227368 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.161440 no
YFB_stipe_shell YFB_gill_tissue 0.001625 yes
YFB_stipe_shell YFB_veil 0.138429 no
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.919232 no
YFB_stipe_skin YFB_gill_tissue 0.072510 no
YFB_stipe_skin YFB_veil 0.910811 no
YFB_cap_skin YFB_cap_tissue 0.000613 yes
YFB_cap_skin YFB_gill_tissue 0.001625 yes
YFB_cap_skin YFB_veil 0.000613 yes
YFB_cap_tissue YFB_gill_tissue 0.124559 no
YFB_cap_tissue YFB_veil 0.993037 no
YFB_gill_tissue YFB_veil 0.120220 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.146589 no
Initials YFB_cap_tissue 0.001625 yes
Initials YFB_gill_tissue 0.238319 no
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.016949 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.265141 no
Initials DIF_cap_tissue 0.018066 yes
Pileal_Stipeal_center DIF_gill_tissue 0.977071 no
Pileal_Stipeal_center YFB_stipe_center 0.062229 no
Pileal_Stipeal_center YFB_stipe_shell 0.530958 no
Pileal_Stipeal_center YFB_stipe_skin 0.725739 no
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.602608 no
Pileal_Stipeal_center YFB_gill_tissue 0.016104 yes
Pileal_Stipeal_center YFB_veil 0.577701 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.103317 no
Pileal_Stipeal_center DIF_stipe_center 0.914529 no
Pileal_Stipeal_center DIF_stipe_shell 0.991064 no
Pileal_Stipeal_center DIF_stipe_skin 0.738140 no
Pileal_Stipeal_center DIF_cap_skin 0.004548 yes
Pileal_Stipeal_center DIF_cap_tissue 0.147674 no
Pileal_Stipeal_shell DIF_gill_tissue 0.084528 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.009123 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.350653 no
Pileal_Stipeal_shell YFB_cap_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.487063 no
Pileal_Stipeal_shell YFB_gill_tissue 0.542093 no
Pileal_Stipeal_shell YFB_veil 0.479870 no
Pileal_Stipeal_shell DIF_stipe_center 0.048422 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.110551 no
Pileal_Stipeal_shell DIF_stipe_skin 0.308159 no
Pileal_Stipeal_shell DIF_cap_skin 0.389457 no
Pileal_Stipeal_shell DIF_cap_tissue 0.957529 no
DIF_stipe_center DIF_gill_tissue 0.939527 no
DIF_stipe_center YFB_stipe_center 0.096131 no
DIF_stipe_center YFB_stipe_shell 0.659301 no
DIF_stipe_center YFB_stipe_skin 0.583082 no
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.458448 no
DIF_stipe_center YFB_gill_tissue 0.008457 yes
DIF_stipe_center YFB_veil 0.429531 no
DIF_stipe_center DIF_stipe_shell 0.904706 no
DIF_stipe_center DIF_stipe_skin 0.594232 no
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.083328 no
DIF_stipe_shell DIF_gill_tissue 0.968777 no
DIF_stipe_shell YFB_stipe_center 0.059906 no
DIF_stipe_shell YFB_stipe_shell 0.521143 no
DIF_stipe_shell YFB_stipe_skin 0.746534 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.620443 no
DIF_stipe_shell YFB_gill_tissue 0.016669 yes
DIF_stipe_shell YFB_veil 0.595164 no
DIF_stipe_shell DIF_stipe_skin 0.757013 no
DIF_stipe_shell DIF_cap_skin 0.004548 yes
DIF_stipe_shell DIF_cap_tissue 0.152872 no
DIF_stipe_skin DIF_gill_tissue 0.699037 no
DIF_stipe_skin YFB_stipe_center 0.009773 yes
DIF_stipe_skin YFB_stipe_shell 0.222588 no
DIF_stipe_skin YFB_stipe_skin 0.985328 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.898154 no
DIF_stipe_skin YFB_gill_tissue 0.063570 no
DIF_stipe_skin YFB_veil 0.887917 no
DIF_stipe_skin DIF_cap_skin 0.018624 yes
DIF_stipe_skin DIF_cap_tissue 0.383392 no
DIF_cap_skin DIF_gill_tissue 0.003765 yes
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.030134 yes
DIF_cap_skin YFB_cap_skin 0.002951 yes
DIF_cap_skin YFB_cap_tissue 0.059318 no
DIF_cap_skin YFB_gill_tissue 0.939640 no
DIF_cap_skin YFB_veil 0.051115 no
DIF_cap_skin DIF_cap_tissue 0.338227 no
DIF_cap_tissue DIF_gill_tissue 0.128955 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.016104 yes
DIF_cap_tissue YFB_stipe_skin 0.430617 no
DIF_cap_tissue YFB_cap_skin 0.000613 yes
DIF_cap_tissue YFB_cap_tissue 0.572650 no
DIF_cap_tissue YFB_gill_tissue 0.485804 no
DIF_cap_tissue YFB_veil 0.566262 no

Orthologs

Orthofinder run ID1
Orthogroup817
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|306400
Agaricus bisporus var bisporus H97 AgabiH97|065230 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|330_7
Rhodonia placenta FPRL280 RhoplFPRL280|515_4
Rhodonia placenta FPRL280 RhoplFPRL280|678_1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|065230
MIFNVKLVLLALVSVVAAQSSSSDTSAPGSSSSSSAASSAASSPPPATTSSPANVTTTISGPFPSGAPADLTACI
LDCVSTAASQSECVSFTNLTCVCTSTAFQSAATSCLMANCTQADVTAATNLQMTQCAAVNGSSGASSMASNTVSN
TASGSGTPIAPPPTGASDMTSPAPSPTAPNGAHMSAASGIWAFAAGLIGIAAAAL*
Coding >AgabiH97|065230
ATGATTTTCAACGTCAAATTGGTTCTCCTGGCCCTCGTTTCCGTAGTGGCAGCCCAGTCTTCATCCTCTGATACT
AGTGCTCCCGGTTCCTCGTCTTCCTCCTCTGCTGCTTCCTCTGCTGCCTCATCCCCGCCTCCTGCAACAACATCC
TCTCCTGCAAATGTTACTACCACTATCAGTGGTCCATTCCCCTCTGGCGCCCCGGCTGATCTGACTGCTTGCATC
CTCGACTGTGTCTCGACCGCTGCTTCACAGAGTGAATGCGTCAGCTTTACCAATCTGACGTGTGTTTGCACGTCT
ACGGCCTTCCAATCAGCTGCAACCAGCTGCCTGATGGCTAATTGTACTCAGGCAGACGTTACCGCAGCTACCAAC
CTCCAAATGACACAATGTGCCGCTGTGAATGGATCTTCTGGTGCCTCTAGTATGGCTTCTAATACTGTATCCAAT
ACTGCCTCCGGTAGTGGCACGCCGATCGCCCCTCCCCCAACTGGGGCATCGGACATGACTTCTCCGGCACCCTCA
CCCACCGCTCCTAATGGTGCTCACATGTCCGCTGCTAGTGGTATTTGGGCCTTTGCTGCTGGTCTTATAGGAATC
GCTGCGGCTGCTCTCTAG
Transcript >AgabiH97|065230
ATGATTTTCAACGTCAAATTGGTTCTCCTGGCCCTCGTTTCCGTAGTGGCAGCCCAGTCTTCATCCTCTGATACT
AGTGCTCCCGGTTCCTCGTCTTCCTCCTCTGCTGCTTCCTCTGCTGCCTCATCCCCGCCTCCTGCAACAACATCC
TCTCCTGCAAATGTTACTACCACTATCAGTGGTCCATTCCCCTCTGGCGCCCCGGCTGATCTGACTGCTTGCATC
CTCGACTGTGTCTCGACCGCTGCTTCACAGAGTGAATGCGTCAGCTTTACCAATCTGACGTGTGTTTGCACGTCT
ACGGCCTTCCAATCAGCTGCAACCAGCTGCCTGATGGCTAATTGTACTCAGGCAGACGTTACCGCAGCTACCAAC
CTCCAAATGACACAATGTGCCGCTGTGAATGGATCTTCTGGTGCCTCTAGTATGGCTTCTAATACTGTATCCAAT
ACTGCCTCCGGTAGTGGCACGCCGATCGCCCCTCCCCCAACTGGGGCATCGGACATGACTTCTCCGGCACCCTCA
CCCACCGCTCCTAATGGTGCTCACATGTCCGCTGCTAGTGGTATTTGGGCCTTTGCTGCTGGTCTTATAGGAATC
GCTGCGGCTGCTCTCTAG
Gene >AgabiH97|065230
ATGATTTTCAACGTCAAATTGGTTCTCCTGGCCCTCGTTTCCGTAGTGGCAGCCCAGTCTTCATCCTCTGATACT
AGTGCTCCCGGTTCCTCGTCTTCCTCCTCTGCTGCTTCCTCTGCTGCCTCATCCCCGCCTCCTGCAACAACATCC
TCTCCTGCAAATGTTACTACCACTATCAGTGGTCCATTCCCCTCTGGCGCCCCGGCTGATCTGACTGCTTGCATC
CTCGACTGTGTCTCGACCGCTGCTTCACAGAGTGAATGCGTCAGCTTGTAATTCGTTTCTTTTTGTTCTGTCTTT
CGACAACTGACTGTCTCATTACAGTACCAATCTGACGTGTGTTTGCACGTCTACGGCCTTCCAATCAGCTGCAAC
CAGCTGCCTGATGGCTAATTGTACTCAGGCAGACGTTACCGCAGCTACCAACCTCCAAATGACACAATGTGCCGC
TGGTATGTGGTTATCGACCTAAAATCCGTTCTATCGTGAGGAATAACGTTTATGAATAGTGAATGGATCTTCTGG
TGCCTCTAGTATGGCTTCTAATACTGTATCCAATACTGCCTCCGGTAGTGGCACGCCGATCGCCCCTCCCCCAAC
TGGGGCATCGGACATGACTTCTCCGGCACCCTCACCCACCGCTCCTAATGGTGCTCACATGTCCGCTGCTAGTGG
TATTTGGGCCTTTGCTGCTGGTCTTATAGGAATCGCTGCGGCTGCTCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail