Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|065200
Gene name
Locationscaffold_3:3045966..3047623
Strand-
Gene length (bp)1657
Transcript length (bp)1335
Coding sequence length (bp)1335
Protein length (aa) 445

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 1.9E-47 133 350

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B9W4V6|APO1_AGRAE Aromatic peroxygenase OS=Agrocybe aegerita GN=APO1 PE=1 SV=1 77 411 4.0E-117
sp|B9W4V8|APO1_COPRA Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 115 348 1.0E-71
sp|Q00668|STCC_EMENI Putative sterigmatocystin biosynthesis peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcC PE=3 SV=2 139 343 7.0E-21
sp|P04963|PRXC_LEPFU Chloroperoxidase OS=Leptoxyphium fumago GN=CPO PE=1 SV=3 134 286 6.0E-07

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 64 86 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|065200
MSNAYVTLELIIDEYDPASPCRKPSAAYDVGPLGYANFAFAKLYQIRKGIKGCLAREGKSVRCSVMVGFLSFVAL
AVALAAPAAAFPAHGSLAGLSRQELDDAMSGFGEYTRPPPPPGPLEYGGVKLVNDADHPFIAPGEGDIRGPCPAL
NTLANHGYISRNGIESPSNIVRGAMEGFNMNNDLSKFTCYAAFMVNGNLITDLVSIGEKSPKTGPDPKEQPMATI
GGLNTHNVFEGDSSMTRADFYDGGDVESFNETLFQGFIEYSNRFGGGRYNLTAAGQFRLKRIQDGVQHNPTFTIV
APRLFSAYSEAVNPINMWVDGRQDDGQLRLDHARSFFEAARFPDDFHRAARPMSADNEAVVHAIHPIEPGANIAG
INTYTVDRNAPRLDDKCGIFEYHVNHTLRTLYPNPTGVAPKSSLTVDSRMAKATTTTRPPITPKSSSPS*
Coding >AgabiH97|065200
ATGTCAAACGCATACGTCACTCTCGAACTGATTATTGACGAATATGACCCCGCCTCACCCTGCAGAAAACCGAGT
GCGGCTTACGACGTCGGTCCTTTAGGCTACGCGAACTTTGCGTTTGCGAAACTGTATCAAATCAGGAAAGGTATA
AAAGGATGCCTGGCAAGAGAAGGAAAATCAGTTCGCTGTTCAGTCATGGTCGGCTTCCTATCCTTCGTTGCGCTC
GCAGTGGCTTTGGCTGCTCCCGCCGCCGCATTCCCAGCACATGGTTCATTGGCTGGCTTGTCGAGGCAAGAATTG
GACGATGCCATGAGTGGCTTCGGCGAATACACAAGGCCACCACCACCCCCAGGACCCCTCGAGTACGGTGGTGTT
AAGTTGGTCAACGATGCCGACCATCCTTTCATTGCTCCGGGTGAAGGCGACATCCGTGGTCCTTGCCCGGCTTTG
AACACTCTCGCCAACCACGGTTACATCAGCCGCAACGGTATTGAGTCACCATCTAACATCGTCCGTGGTGCCATG
GAAGGTTTCAACATGAACAACGACTTGTCCAAGTTCACCTGTTACGCTGCCTTCATGGTCAACGGAAACTTGATC
ACTGACTTGGTCAGTATTGGTGAGAAGTCCCCGAAGACCGGACCAGACCCAAAAGAACAACCGATGGCGACTATT
GGTGGTTTGAACACTCACAACGTGTTCGAGGGTGACAGTTCTATGACTCGCGCTGATTTCTATGATGGTGGTGAT
GTCGAGAGCTTCAACGAGACCCTTTTCCAAGGATTCATTGAATACAGCAACAGGTTCGGTGGTGGAAGGTACAAC
CTTACCGCCGCTGGCCAGTTCCGTCTCAAACGTATCCAAGATGGTGTCCAACACAACCCGACCTTCACCATCGTC
GCTCCCCGACTCTTCTCTGCTTACTCCGAAGCCGTCAACCCCATCAACATGTGGGTCGATGGACGCCAAGACGAT
GGTCAACTCAGGCTCGACCATGCCCGCAGCTTCTTCGAAGCCGCACGTTTCCCCGATGACTTCCACAGGGCTGCA
CGCCCCATGAGCGCCGACAACGAGGCCGTTGTACACGCTATCCACCCCATTGAGCCAGGAGCAAACATCGCCGGT
ATCAACACTTACACTGTTGACCGTAATGCACCCAGACTTGACGACAAGTGCGGTATCTTCGAGTACCACGTCAAC
CACACTCTCCGCACTCTCTACCCCAACCCGACCGGGGTTGCACCGAAATCTTCCCTTACGGTAGATTCGAGGATG
GCGAAAGCAACAACTACTACGCGACCCCCGATTACCCCGAAGTCGAGCTCCCCGAGCTAG
Transcript >AgabiH97|065200
ATGTCAAACGCATACGTCACTCTCGAACTGATTATTGACGAATATGACCCCGCCTCACCCTGCAGAAAACCGAGT
GCGGCTTACGACGTCGGTCCTTTAGGCTACGCGAACTTTGCGTTTGCGAAACTGTATCAAATCAGGAAAGGTATA
AAAGGATGCCTGGCAAGAGAAGGAAAATCAGTTCGCTGTTCAGTCATGGTCGGCTTCCTATCCTTCGTTGCGCTC
GCAGTGGCTTTGGCTGCTCCCGCCGCCGCATTCCCAGCACATGGTTCATTGGCTGGCTTGTCGAGGCAAGAATTG
GACGATGCCATGAGTGGCTTCGGCGAATACACAAGGCCACCACCACCCCCAGGACCCCTCGAGTACGGTGGTGTT
AAGTTGGTCAACGATGCCGACCATCCTTTCATTGCTCCGGGTGAAGGCGACATCCGTGGTCCTTGCCCGGCTTTG
AACACTCTCGCCAACCACGGTTACATCAGCCGCAACGGTATTGAGTCACCATCTAACATCGTCCGTGGTGCCATG
GAAGGTTTCAACATGAACAACGACTTGTCCAAGTTCACCTGTTACGCTGCCTTCATGGTCAACGGAAACTTGATC
ACTGACTTGGTCAGTATTGGTGAGAAGTCCCCGAAGACCGGACCAGACCCAAAAGAACAACCGATGGCGACTATT
GGTGGTTTGAACACTCACAACGTGTTCGAGGGTGACAGTTCTATGACTCGCGCTGATTTCTATGATGGTGGTGAT
GTCGAGAGCTTCAACGAGACCCTTTTCCAAGGATTCATTGAATACAGCAACAGGTTCGGTGGTGGAAGGTACAAC
CTTACCGCCGCTGGCCAGTTCCGTCTCAAACGTATCCAAGATGGTGTCCAACACAACCCGACCTTCACCATCGTC
GCTCCCCGACTCTTCTCTGCTTACTCCGAAGCCGTCAACCCCATCAACATGTGGGTCGATGGACGCCAAGACGAT
GGTCAACTCAGGCTCGACCATGCCCGCAGCTTCTTCGAAGCCGCACGTTTCCCCGATGACTTCCACAGGGCTGCA
CGCCCCATGAGCGCCGACAACGAGGCCGTTGTACACGCTATCCACCCCATTGAGCCAGGAGCAAACATCGCCGGT
ATCAACACTTACACTGTTGACCGTAATGCACCCAGACTTGACGACAAGTGCGGTATCTTCGAGTACCACGTCAAC
CACACTCTCCGCACTCTCTACCCCAACCCGACCGGGGTTGCACCGAAATCTTCCCTTACGGTAGATTCGAGGATG
GCGAAAGCAACAACTACTACGCGACCCCCGATTACCCCGAAGTCGAGCTCCCCGAGCTAG
Gene >AgabiH97|065200
ATGTCAAACGCATACGTCACTCTCGAACTGATTATTGACGAATATGACCCCGCCTCACCCTGCAGAAAACCGAGT
GCGGCTGTATGTCAGAGAGTACTTGATGTCTCGAACCTTTCTCACACCCGGCAGTACGACGTCGGTCCTTTAGGC
TACGCGAACTTTGCGTTTGCGAAACTGTATCAAATCAGGAAAGGTATAAAAGGATGCCTGGCAAGAGAAGGAAAA
TCAGTTCGCTGTTCAGTCATGGTCGGCTTCCTATCCTTCGTTGCGCTCGCAGTGGCTTTGGCTGCTCCCGCCGCC
GCATTCCCAGCACATGGTTCATTGGCTGGCTTGTCGAGGCAAGAATTGGACGATGCCATGAGTGGCTTCGGCGAA
TACACAAGGCCACCACCACCCCCAGGACCCCTCGAGTACGGTGGTGTTAAGTTGGTCAACGATGCCGACCATCCT
TTCATTGCTCCGGGTGAAGGCGACATCCGTGGTCCTTGCCCGGCTTTGAACACTCTCGCCAACCACGGTGTACGT
ACCATTTTTCTAGTTTGCTTCTCGGTAACATCTGACCCCAAATTGACAGTACATCAGCCGCAACGGTATTGAGTC
ACCATCTAACATCGTCCGTGGTGCCATGGAAGGTCAGTGCTTCAGGTCTTCCTTCACGTCCTTTCGCTGACTTTG
AGCAGGTTTCAACATGAACAACGACTTGTCCAAGTTCACCTGTTACGCTGCCTTCATGGTCAACGGAAACTTGAT
CACTGACTTGGTCAGTATTGGTGAGAAGTCCCCGAAGACCGGACCAGACCCAAAAGAACAACCGATGGCGACTAT
TGGTGGTTTGAACACTCACAACGTGTTCGAGGGTGACAGTTCTATGACTCGCGGTGAGTTTCGCGTATTGCCATA
GTTATCCTAATCAAGTGGCTTACTTGGTCTCCAGCTGATTTCTATGATGGTGGTGATGTCGAGAGCTTCAACGAG
ACCCTTTTCCAAGGAGTATGTTATCTCCCATATTTTGACGCTTCCAGGATCTGACCACTTCGATCACAGTTCATT
GAATACAGCAACAGGTTCGGTGGTGGAAGGTACAACCTTACCGCCGCTGGCCAGTTCCGTCTCAAACGTATCCAA
GATGGTGTCCAACACAACCCGACCTTCACCATCGTCGCTCCCCGACTCTTCTCTGCTTACTCCGAAGCCGTCAAC
CCCATCAACATGTGGGTCGATGGACGCCAAGACGATGGTCAACTCAGGCTCGACCATGCCCGCAGCTTCTTCGAA
GCCGCACGTTTCCCCGATGACTTCCACAGGGCTGCACGCCCCATGAGCGCCGACAACGAGGCCGTTGTACACGCT
ATCCACCCCATTGAGCCAGGAGCAAACATCGCCGGTATCAACACTTACACTGTTGACCGTAATGCACCCAGACTT
GACGACAAGTGCGGTATCTTCGAGTACCACGTCAACCACACTCTCCGCACTCTCTACCCCAACCCGACCGGTAAC
TTGTTGGACGCCATCAGGGCCAACATCCACTATTTCTTCACCGCTATGGAGGCTAGGGGTTGCACCGAAATCTTC
CCTTACGGTAGATTCGAGGATGGCGAAAGCAACAACTACTACGCGACCCCCGATTACCCCGAAGTCGAGCTCCCC
GAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail