Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|065120
Gene name
Locationscaffold_3:3025847..3026239
Strand-
Gene length (bp)392
Transcript length (bp)339
Coding sequence length (bp)339
Protein length (aa) 113

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 8.0E-18 68 111

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B9W4V6|APO1_AGRAE Aromatic peroxygenase OS=Agrocybe aegerita GN=APO1 PE=1 SV=1 11 112 6.0E-26
sp|B9W4V8|APO1_COPRA Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 50 112 3.0E-16
sp|P04963|PRXC_LEPFU Chloroperoxidase OS=Leptoxyphium fumago GN=CPO PE=1 SV=3 69 98 3.0E-06

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 23.30 8.21 38.39
Initials Initials knots 32.06 12.97 51.14
Pileal_Stipeal_center Stage I stipe center 12.23 3.62 20.85
Pileal_Stipeal_shell Stage I stipe shell 12.28 3.30 21.25
DIF_stipe_center Stage II stipe center 10.71 3.10 18.32
DIF_stipe_shell Stage II stipe shell 8.04 1.94 14.13
DIF_stipe_skin Stage II stipe skin 13.27 4.21 22.32
DIF_cap_skin Stage II cap skin 8.37 1.74 15.00
DIF_cap_tissue Stage II cap tissue 6.27 1.10 11.44
DIF_gill_tissue Stage II gill tissue 8.68 2.21 15.16
YFB_stipe_center Young fruiting body stipe center 11.64 3.00 20.28
YFB_stipe_shell Young fruiting body stipe shell 12.73 3.95 21.50
YFB_stipe_skin Young fruiting body stipe skin 11.00 2.99 19.01
YFB_cap_skin Young fruiting body cap skin 8.39 2.06 14.71
YFB_cap_tissue Young fruiting body cap tissue 6.58 1.10 12.06
YFB_gill_tissue Young fruiting body gill tissue 12.48 3.85 21.11
YFB_veil Young fruiting body veil 9.57 2.52 16.62

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.038720 yes
Casing YFB_stipe_center 0.156253 no
Casing YFB_stipe_shell 0.212940 no
Casing YFB_stipe_skin 0.135445 no
Casing YFB_cap_skin 0.031800 yes
Casing YFB_cap_tissue 0.010728 yes
Casing YFB_gill_tissue 0.190735 no
Casing YFB_veil 0.064705 no
Casing Initials 0.570379 no
Casing Pileal_Stipeal_center 0.172056 no
Casing Pileal_Stipeal_shell 0.200095 no
Casing DIF_stipe_center 0.089301 no
Casing DIF_stipe_shell 0.023153 yes
Casing DIF_stipe_skin 0.258617 no
Casing DIF_cap_skin 0.036911 yes
Casing DIF_cap_tissue 0.012577 yes
DIF_gill_tissue YFB_stipe_center 0.701001 no
DIF_gill_tissue YFB_stipe_shell 0.568695 no
DIF_gill_tissue YFB_stipe_skin 0.777393 no
DIF_gill_tissue YFB_cap_skin 0.975000 no
DIF_gill_tissue YFB_cap_tissue 0.736594 no
DIF_gill_tissue YFB_gill_tissue 0.596031 no
DIF_gill_tissue YFB_veil 0.920629 no
YFB_stipe_center YFB_stipe_shell 0.922344 no
YFB_stipe_center YFB_stipe_skin 0.955008 no
YFB_stipe_center YFB_cap_skin 0.643684 no
YFB_stipe_center YFB_cap_tissue 0.359432 no
YFB_stipe_center YFB_gill_tissue 0.942771 no
YFB_stipe_center YFB_veil 0.814412 no
YFB_stipe_shell YFB_stipe_skin 0.867032 no
YFB_stipe_shell YFB_cap_skin 0.508150 no
YFB_stipe_shell YFB_cap_tissue 0.255688 no
YFB_stipe_shell YFB_gill_tissue 0.982723 no
YFB_stipe_shell YFB_veil 0.691202 no
YFB_stipe_skin YFB_cap_skin 0.725863 no
YFB_stipe_skin YFB_cap_tissue 0.434560 no
YFB_stipe_skin YFB_gill_tissue 0.888897 no
YFB_stipe_skin YFB_veil 0.879399 no
YFB_cap_skin YFB_cap_tissue 0.775599 no
YFB_cap_skin YFB_gill_tissue 0.542276 no
YFB_cap_skin YFB_veil 0.886901 no
YFB_cap_tissue YFB_gill_tissue 0.266649 no
YFB_cap_tissue YFB_veil 0.615023 no
YFB_gill_tissue YFB_veil 0.722261 no
Initials DIF_gill_tissue 0.003765 yes
Initials YFB_stipe_center 0.024187 yes
Initials YFB_stipe_shell 0.033444 yes
Initials YFB_stipe_skin 0.021056 yes
Initials YFB_cap_skin 0.002951 yes
Initials YFB_cap_tissue 0.001625 yes
Initials YFB_gill_tissue 0.027698 yes
Initials YFB_veil 0.011659 yes
Initials Pileal_Stipeal_center 0.024444 yes
Initials Pileal_Stipeal_shell 0.039390 yes
Initials DIF_stipe_center 0.008121 yes
Initials DIF_stipe_shell 0.002951 yes
Initials DIF_stipe_skin 0.046327 yes
Initials DIF_cap_skin 0.004160 yes
Initials DIF_cap_tissue 0.001625 yes
Pileal_Stipeal_center DIF_gill_tissue 0.616889 no
Pileal_Stipeal_center YFB_stipe_center 0.958803 no
Pileal_Stipeal_center YFB_stipe_shell 0.965710 no
Pileal_Stipeal_center YFB_stipe_skin 0.909106 no
Pileal_Stipeal_center YFB_cap_skin 0.568591 no
Pileal_Stipeal_center YFB_cap_tissue 0.296498 no
Pileal_Stipeal_center YFB_gill_tissue 0.983154 no
Pileal_Stipeal_center YFB_veil 0.745745 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.994180 no
Pileal_Stipeal_center DIF_stipe_center 0.877021 no
Pileal_Stipeal_center DIF_stipe_shell 0.513846 no
Pileal_Stipeal_center DIF_stipe_skin 0.929558 no
Pileal_Stipeal_center DIF_cap_skin 0.575041 no
Pileal_Stipeal_center DIF_cap_tissue 0.259483 no
Pileal_Stipeal_shell DIF_gill_tissue 0.622172 no
Pileal_Stipeal_shell YFB_stipe_center 0.957320 no
Pileal_Stipeal_shell YFB_stipe_shell 0.969078 no
Pileal_Stipeal_shell YFB_stipe_skin 0.907402 no
Pileal_Stipeal_shell YFB_cap_skin 0.574403 no
Pileal_Stipeal_shell YFB_cap_tissue 0.307860 no
Pileal_Stipeal_shell YFB_gill_tissue 0.984130 no
Pileal_Stipeal_shell YFB_veil 0.751158 no
Pileal_Stipeal_shell DIF_stipe_center 0.876301 no
Pileal_Stipeal_shell DIF_stipe_shell 0.519590 no
Pileal_Stipeal_shell DIF_stipe_skin 0.934449 no
Pileal_Stipeal_shell DIF_cap_skin 0.581233 no
Pileal_Stipeal_shell DIF_cap_tissue 0.268874 no
DIF_stipe_center DIF_gill_tissue 0.794548 no
DIF_stipe_center YFB_stipe_center 0.928972 no
DIF_stipe_center YFB_stipe_shell 0.829521 no
DIF_stipe_center YFB_stipe_skin 0.979366 no
DIF_stipe_center YFB_cap_skin 0.749909 no
DIF_stipe_center YFB_cap_tissue 0.449219 no
DIF_stipe_center YFB_gill_tissue 0.855210 no
DIF_stipe_center YFB_veil 0.900878 no
DIF_stipe_center DIF_stipe_shell 0.696758 no
DIF_stipe_center DIF_stipe_skin 0.778273 no
DIF_stipe_center DIF_cap_skin 0.752027 no
DIF_stipe_center DIF_cap_tissue 0.402915 no
DIF_stipe_shell DIF_gill_tissue 0.939253 no
DIF_stipe_shell YFB_stipe_center 0.590463 no
DIF_stipe_shell YFB_stipe_shell 0.453444 no
DIF_stipe_shell YFB_stipe_skin 0.676468 no
DIF_stipe_shell YFB_cap_skin 0.967002 no
DIF_stipe_shell YFB_cap_tissue 0.823300 no
DIF_stipe_shell YFB_gill_tissue 0.480884 no
DIF_stipe_shell YFB_veil 0.842919 no
DIF_stipe_shell DIF_stipe_skin 0.397055 no
DIF_stipe_shell DIF_cap_skin 0.969262 no
DIF_stipe_shell DIF_cap_tissue 0.778124 no
DIF_stipe_skin DIF_gill_tissue 0.504645 no
DIF_stipe_skin YFB_stipe_center 0.881115 no
DIF_stipe_skin YFB_stipe_shell 0.964524 no
DIF_stipe_skin YFB_stipe_skin 0.822018 no
DIF_stipe_skin YFB_cap_skin 0.460436 no
DIF_stipe_skin YFB_cap_tissue 0.223034 no
DIF_stipe_skin YFB_gill_tissue 0.948619 no
DIF_stipe_skin YFB_veil 0.638782 no
DIF_stipe_skin DIF_cap_skin 0.466295 no
DIF_stipe_skin DIF_cap_tissue 0.192167 no
DIF_cap_skin DIF_gill_tissue 0.971947 no
DIF_cap_skin YFB_stipe_center 0.655052 no
DIF_cap_skin YFB_stipe_shell 0.522767 no
DIF_cap_skin YFB_stipe_skin 0.736440 no
DIF_cap_skin YFB_cap_skin 0.993037 no
DIF_cap_skin YFB_cap_tissue 0.784052 no
DIF_cap_skin YFB_gill_tissue 0.548548 no
DIF_cap_skin YFB_veil 0.888319 no
DIF_cap_skin DIF_cap_tissue 0.735178 no
DIF_cap_tissue DIF_gill_tissue 0.680979 no
DIF_cap_tissue YFB_stipe_center 0.323611 no
DIF_cap_tissue YFB_stipe_shell 0.225814 no
DIF_cap_tissue YFB_stipe_skin 0.396977 no
DIF_cap_tissue YFB_cap_skin 0.722737 no
DIF_cap_tissue YFB_cap_tissue 0.964497 no
DIF_cap_tissue YFB_gill_tissue 0.240070 no
DIF_cap_tissue YFB_veil 0.562753 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|065120
MVGFLSFVTLAIALAAPAAAFPAHGSLAGLSRQELDDAMSGFGEYTRPPPPPGPLEYGGVKLVNDAEHPFIAPGE
GDIRGPCPALNTLANHGYISRNGIESPSNIVRGAMEG*
Coding >AgabiH97|065120
ATGGTCGGCTTCCTATCCTTCGTCACCCTCGCAATCGCGCTGGCTGCTCCCGCTGCCGCATTCCCAGCTCATGGT
TCATTGGCTGGCTTGTCGAGGCAAGAGTTGGACGATGCCATGAGTGGCTTCGGCGAATACACAAGGCCACCACCA
CCCCCAGGACCCCTCGAGTACGGTGGTGTTAAGCTGGTCAACGATGCCGAACATCCTTTCATTGCTCCGGGTGAA
GGCGACATCCGTGGTCCTTGCCCGGCTTTGAACACTCTCGCCAACCACGGTTACATCAGCCGCAATGGTATTGAG
TCTCCTTCTAACATCGTCCGTGGTGCCATGGAAGGTTAG
Transcript >AgabiH97|065120
ATGGTCGGCTTCCTATCCTTCGTCACCCTCGCAATCGCGCTGGCTGCTCCCGCTGCCGCATTCCCAGCTCATGGT
TCATTGGCTGGCTTGTCGAGGCAAGAGTTGGACGATGCCATGAGTGGCTTCGGCGAATACACAAGGCCACCACCA
CCCCCAGGACCCCTCGAGTACGGTGGTGTTAAGCTGGTCAACGATGCCGAACATCCTTTCATTGCTCCGGGTGAA
GGCGACATCCGTGGTCCTTGCCCGGCTTTGAACACTCTCGCCAACCACGGTTACATCAGCCGCAATGGTATTGAG
TCTCCTTCTAACATCGTCCGTGGTGCCATGGAAGGTTAG
Gene >AgabiH97|065120
ATGGTCGGCTTCCTATCCTTCGTCACCCTCGCAATCGCGCTGGCTGCTCCCGCTGCCGCATTCCCAGCTCATGGT
TCATTGGCTGGCTTGTCGAGGCAAGAGTTGGACGATGCCATGAGTGGCTTCGGCGAATACACAAGGCCACCACCA
CCCCCAGGACCCCTCGAGTACGGTGGTGTTAAGCTGGTCAACGATGCCGAACATCCTTTCATTGCTCCGGGTGAA
GGCGACATCCGTGGTCCTTGCCCGGCTTTGAACACTCTCGCCAACCACGGTGTACGTACCATTTTATAGCCTGCT
TCTCGCTAATATCTGACCGCAAATCACAGTACATCAGCCGCAATGGTATTGAGTCTCCTTCTAACATCGTCCGTG
GTGCCATGGAAGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail