© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|065120 |
| Gene name | |
| Location | scaffold_3:3025847..3026239 |
| Strand | - |
| Gene length (bp) | 392 |
| Transcript length (bp) | 339 |
| Coding sequence length (bp) | 339 |
| Protein length (aa) | 113 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01328 | Peroxidase_2 | Peroxidase, family 2 | 8.0E-18 | 68 | 111 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|B9W4V6|APO1_AGRAE | Aromatic peroxygenase OS=Agrocybe aegerita GN=APO1 PE=1 SV=1 | 11 | 112 | 6.0E-26 |
| sp|B9W4V8|APO1_COPRA | Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 | 50 | 112 | 3.0E-16 |
| sp|P04963|PRXC_LEPFU | Chloroperoxidase OS=Leptoxyphium fumago GN=CPO PE=1 SV=3 | 69 | 98 | 3.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0004601 | peroxidase activity | Yes |
| GO:0003674 | molecular_function | No |
| GO:0016491 | oxidoreductase activity | No |
| GO:0016209 | antioxidant activity | No |
| GO:0003824 | catalytic activity | No |
| GO:0016684 | oxidoreductase activity, acting on peroxide as acceptor | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 21 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 23.30 | 8.21 | 38.39 |
| Initials | Initials knots | 32.06 | 12.97 | 51.14 |
| Pileal_Stipeal_center | Stage I stipe center | 12.23 | 3.62 | 20.85 |
| Pileal_Stipeal_shell | Stage I stipe shell | 12.28 | 3.30 | 21.25 |
| DIF_stipe_center | Stage II stipe center | 10.71 | 3.10 | 18.32 |
| DIF_stipe_shell | Stage II stipe shell | 8.04 | 1.94 | 14.13 |
| DIF_stipe_skin | Stage II stipe skin | 13.27 | 4.21 | 22.32 |
| DIF_cap_skin | Stage II cap skin | 8.37 | 1.74 | 15.00 |
| DIF_cap_tissue | Stage II cap tissue | 6.27 | 1.10 | 11.44 |
| DIF_gill_tissue | Stage II gill tissue | 8.68 | 2.21 | 15.16 |
| YFB_stipe_center | Young fruiting body stipe center | 11.64 | 3.00 | 20.28 |
| YFB_stipe_shell | Young fruiting body stipe shell | 12.73 | 3.95 | 21.50 |
| YFB_stipe_skin | Young fruiting body stipe skin | 11.00 | 2.99 | 19.01 |
| YFB_cap_skin | Young fruiting body cap skin | 8.39 | 2.06 | 14.71 |
| YFB_cap_tissue | Young fruiting body cap tissue | 6.58 | 1.10 | 12.06 |
| YFB_gill_tissue | Young fruiting body gill tissue | 12.48 | 3.85 | 21.11 |
| YFB_veil | Young fruiting body veil | 9.57 | 2.52 | 16.62 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.038720 | yes |
| Casing | YFB_stipe_center | 0.156253 | no |
| Casing | YFB_stipe_shell | 0.212940 | no |
| Casing | YFB_stipe_skin | 0.135445 | no |
| Casing | YFB_cap_skin | 0.031800 | yes |
| Casing | YFB_cap_tissue | 0.010728 | yes |
| Casing | YFB_gill_tissue | 0.190735 | no |
| Casing | YFB_veil | 0.064705 | no |
| Casing | Initials | 0.570379 | no |
| Casing | Pileal_Stipeal_center | 0.172056 | no |
| Casing | Pileal_Stipeal_shell | 0.200095 | no |
| Casing | DIF_stipe_center | 0.089301 | no |
| Casing | DIF_stipe_shell | 0.023153 | yes |
| Casing | DIF_stipe_skin | 0.258617 | no |
| Casing | DIF_cap_skin | 0.036911 | yes |
| Casing | DIF_cap_tissue | 0.012577 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.701001 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.568695 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.777393 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.975000 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.736594 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.596031 | no |
| DIF_gill_tissue | YFB_veil | 0.920629 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.922344 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.955008 | no |
| YFB_stipe_center | YFB_cap_skin | 0.643684 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.359432 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.942771 | no |
| YFB_stipe_center | YFB_veil | 0.814412 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.867032 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.508150 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.255688 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.982723 | no |
| YFB_stipe_shell | YFB_veil | 0.691202 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.725863 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.434560 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.888897 | no |
| YFB_stipe_skin | YFB_veil | 0.879399 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.775599 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.542276 | no |
| YFB_cap_skin | YFB_veil | 0.886901 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.266649 | no |
| YFB_cap_tissue | YFB_veil | 0.615023 | no |
| YFB_gill_tissue | YFB_veil | 0.722261 | no |
| Initials | DIF_gill_tissue | 0.003765 | yes |
| Initials | YFB_stipe_center | 0.024187 | yes |
| Initials | YFB_stipe_shell | 0.033444 | yes |
| Initials | YFB_stipe_skin | 0.021056 | yes |
| Initials | YFB_cap_skin | 0.002951 | yes |
| Initials | YFB_cap_tissue | 0.001625 | yes |
| Initials | YFB_gill_tissue | 0.027698 | yes |
| Initials | YFB_veil | 0.011659 | yes |
| Initials | Pileal_Stipeal_center | 0.024444 | yes |
| Initials | Pileal_Stipeal_shell | 0.039390 | yes |
| Initials | DIF_stipe_center | 0.008121 | yes |
| Initials | DIF_stipe_shell | 0.002951 | yes |
| Initials | DIF_stipe_skin | 0.046327 | yes |
| Initials | DIF_cap_skin | 0.004160 | yes |
| Initials | DIF_cap_tissue | 0.001625 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.616889 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.958803 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.965710 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.909106 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.568591 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.296498 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.983154 | no |
| Pileal_Stipeal_center | YFB_veil | 0.745745 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.994180 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.877021 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.513846 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.929558 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.575041 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.259483 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.622172 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.957320 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.969078 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.907402 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.574403 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.307860 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.984130 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.751158 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.876301 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.519590 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.934449 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.581233 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.268874 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.794548 | no |
| DIF_stipe_center | YFB_stipe_center | 0.928972 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.829521 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.979366 | no |
| DIF_stipe_center | YFB_cap_skin | 0.749909 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.449219 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.855210 | no |
| DIF_stipe_center | YFB_veil | 0.900878 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.696758 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.778273 | no |
| DIF_stipe_center | DIF_cap_skin | 0.752027 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.402915 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.939253 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.590463 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.453444 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.676468 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.967002 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.823300 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.480884 | no |
| DIF_stipe_shell | YFB_veil | 0.842919 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.397055 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.969262 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.778124 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.504645 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.881115 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.964524 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.822018 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.460436 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.223034 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.948619 | no |
| DIF_stipe_skin | YFB_veil | 0.638782 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.466295 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.192167 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.971947 | no |
| DIF_cap_skin | YFB_stipe_center | 0.655052 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.522767 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.736440 | no |
| DIF_cap_skin | YFB_cap_skin | 0.993037 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.784052 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.548548 | no |
| DIF_cap_skin | YFB_veil | 0.888319 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.735178 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.680979 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.323611 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.225814 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.396977 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.722737 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.964497 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.240070 | no |
| DIF_cap_tissue | YFB_veil | 0.562753 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|065120 MVGFLSFVTLAIALAAPAAAFPAHGSLAGLSRQELDDAMSGFGEYTRPPPPPGPLEYGGVKLVNDAEHPFIAPGE GDIRGPCPALNTLANHGYISRNGIESPSNIVRGAMEG* |
| Coding | >AgabiH97|065120 ATGGTCGGCTTCCTATCCTTCGTCACCCTCGCAATCGCGCTGGCTGCTCCCGCTGCCGCATTCCCAGCTCATGGT TCATTGGCTGGCTTGTCGAGGCAAGAGTTGGACGATGCCATGAGTGGCTTCGGCGAATACACAAGGCCACCACCA CCCCCAGGACCCCTCGAGTACGGTGGTGTTAAGCTGGTCAACGATGCCGAACATCCTTTCATTGCTCCGGGTGAA GGCGACATCCGTGGTCCTTGCCCGGCTTTGAACACTCTCGCCAACCACGGTTACATCAGCCGCAATGGTATTGAG TCTCCTTCTAACATCGTCCGTGGTGCCATGGAAGGTTAG |
| Transcript | >AgabiH97|065120 ATGGTCGGCTTCCTATCCTTCGTCACCCTCGCAATCGCGCTGGCTGCTCCCGCTGCCGCATTCCCAGCTCATGGT TCATTGGCTGGCTTGTCGAGGCAAGAGTTGGACGATGCCATGAGTGGCTTCGGCGAATACACAAGGCCACCACCA CCCCCAGGACCCCTCGAGTACGGTGGTGTTAAGCTGGTCAACGATGCCGAACATCCTTTCATTGCTCCGGGTGAA GGCGACATCCGTGGTCCTTGCCCGGCTTTGAACACTCTCGCCAACCACGGTTACATCAGCCGCAATGGTATTGAG TCTCCTTCTAACATCGTCCGTGGTGCCATGGAAGGTTAG |
| Gene | >AgabiH97|065120 ATGGTCGGCTTCCTATCCTTCGTCACCCTCGCAATCGCGCTGGCTGCTCCCGCTGCCGCATTCCCAGCTCATGGT TCATTGGCTGGCTTGTCGAGGCAAGAGTTGGACGATGCCATGAGTGGCTTCGGCGAATACACAAGGCCACCACCA CCCCCAGGACCCCTCGAGTACGGTGGTGTTAAGCTGGTCAACGATGCCGAACATCCTTTCATTGCTCCGGGTGAA GGCGACATCCGTGGTCCTTGCCCGGCTTTGAACACTCTCGCCAACCACGGTGTACGTACCATTTTATAGCCTGCT TCTCGCTAATATCTGACCGCAAATCACAGTACATCAGCCGCAATGGTATTGAGTCTCCTTCTAACATCGTCCGTG GTGCCATGGAAGGTTAG |