Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|065070
Gene name
Locationscaffold_3:3012968..3014565
Strand+
Gene length (bp)1597
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 1.1E-47 68 284

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B9W4V6|APO1_AGRAE Aromatic peroxygenase OS=Agrocybe aegerita GN=APO1 PE=1 SV=1 11 376 2.0E-131
sp|B9W4V8|APO1_COPRA Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 50 282 2.0E-75
sp|Q00668|STCC_EMENI Putative sterigmatocystin biosynthesis peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcC PE=3 SV=2 70 277 1.0E-20
sp|P04963|PRXC_LEPFU Chloroperoxidase OS=Leptoxyphium fumago GN=CPO PE=1 SV=3 69 220 6.0E-07

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 2 24 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 68.56 40.36 96.77
Initials Initials knots 89.00 52.35 125.64
Pileal_Stipeal_center Stage I stipe center 62.16 32.34 91.98
Pileal_Stipeal_shell Stage I stipe shell 6.45 3.02 9.87
DIF_stipe_center Stage II stipe center 8.99 4.42 13.55
DIF_stipe_shell Stage II stipe shell 10.93 5.53 16.32
DIF_stipe_skin Stage II stipe skin 47.99 25.84 70.14
DIF_cap_skin Stage II cap skin 6.41 3.02 9.81
DIF_cap_tissue Stage II cap tissue 5.01 2.27 7.75
DIF_gill_tissue Stage II gill tissue 5.20 2.36 8.04
YFB_stipe_center Young fruiting body stipe center 44.30 21.77 66.82
YFB_stipe_shell Young fruiting body stipe shell 17.76 8.94 26.59
YFB_stipe_skin Young fruiting body stipe skin 29.82 15.22 44.42
YFB_cap_skin Young fruiting body cap skin 5.88 2.70 9.06
YFB_cap_tissue Young fruiting body cap tissue 5.45 2.49 8.41
YFB_gill_tissue Young fruiting body gill tissue 8.96 4.37 13.55
YFB_veil Young fruiting body veil 7.07 3.32 10.82

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.189160 no
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.003365 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.447840 no
Casing Pileal_Stipeal_center 0.852043 no
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.281547 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.845596 no
DIF_gill_tissue YFB_cap_tissue 0.948381 no
DIF_gill_tissue YFB_gill_tissue 0.151247 no
DIF_gill_tissue YFB_veil 0.507842 no
YFB_stipe_center YFB_stipe_shell 0.002525 yes
YFB_stipe_center YFB_stipe_skin 0.293472 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.128073 no
YFB_stipe_shell YFB_cap_skin 0.001140 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.040501 yes
YFB_stipe_shell YFB_veil 0.002084 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.912882 no
YFB_cap_skin YFB_gill_tissue 0.312500 no
YFB_cap_skin YFB_veil 0.744770 no
YFB_cap_tissue YFB_gill_tissue 0.207043 no
YFB_cap_tissue YFB_veil 0.599180 no
YFB_gill_tissue YFB_veil 0.634381 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.024946 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.311838 no
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.031557 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_stipe_center 0.402600 no
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.022111 yes
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_veil 0.000613 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.000613 yes
Pileal_Stipeal_center DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_skin 0.545643 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.695138 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.001140 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.890990 no
Pileal_Stipeal_shell YFB_cap_tissue 0.776915 no
Pileal_Stipeal_shell YFB_gill_tissue 0.463813 no
Pileal_Stipeal_shell YFB_veil 0.886555 no
Pileal_Stipeal_shell DIF_stipe_center 0.444998 no
Pileal_Stipeal_shell DIF_stipe_shell 0.150706 no
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.993433 no
Pileal_Stipeal_shell DIF_cap_tissue 0.627468 no
DIF_stipe_center DIF_gill_tissue 0.143342 no
DIF_stipe_center YFB_stipe_center 0.000613 yes
DIF_stipe_center YFB_stipe_shell 0.030610 yes
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.293872 no
DIF_stipe_center YFB_cap_tissue 0.191454 no
DIF_stipe_center YFB_gill_tissue 0.996132 no
DIF_stipe_center YFB_veil 0.615931 no
DIF_stipe_center DIF_stipe_shell 0.684639 no
DIF_stipe_center DIF_stipe_skin 0.000613 yes
DIF_stipe_center DIF_cap_skin 0.420707 no
DIF_stipe_center DIF_cap_tissue 0.112576 no
DIF_stipe_shell DIF_gill_tissue 0.031088 yes
DIF_stipe_shell YFB_stipe_center 0.000613 yes
DIF_stipe_shell YFB_stipe_shell 0.162227 no
DIF_stipe_shell YFB_stipe_skin 0.001140 yes
DIF_stipe_shell YFB_cap_skin 0.082106 no
DIF_stipe_shell YFB_cap_tissue 0.043339 yes
DIF_stipe_shell YFB_gill_tissue 0.689750 no
DIF_stipe_shell YFB_veil 0.252939 no
DIF_stipe_shell DIF_stipe_skin 0.000613 yes
DIF_stipe_shell DIF_cap_skin 0.129965 no
DIF_stipe_shell DIF_cap_tissue 0.024187 yes
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.892096 no
DIF_stipe_skin YFB_stipe_shell 0.000613 yes
DIF_stipe_skin YFB_stipe_skin 0.159459 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_veil 0.000613 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.693072 no
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.001140 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.894211 no
DIF_cap_skin YFB_cap_tissue 0.776605 no
DIF_cap_skin YFB_gill_tissue 0.436563 no
DIF_cap_skin YFB_veil 0.875261 no
DIF_cap_skin DIF_cap_tissue 0.622063 no
DIF_cap_tissue DIF_gill_tissue 0.961091 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.788689 no
DIF_cap_tissue YFB_cap_tissue 0.901940 no
DIF_cap_tissue YFB_gill_tissue 0.119007 no
DIF_cap_tissue YFB_veil 0.435715 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|065070
MVGFISFVVLAVALVAPAAAFPAHGSLAGLSRQELDDAMSAFGKYKRPPPPPGPLEYGGVKLVNDAEHPFKPPRK
GDIRGPCPALNTLANHGYISRNGIESPSNIVRAAMEGFNMNNDLAKFTCYAAFIVNGNMVTDLVSIGEKSKKTGP
DPKDQPATIGGLNTHNVFEGDSSMTRADFYDGGDVESFNETLFQGFLEYSYRFGGGRYNLTAAGEYRLKRTQDGI
QNNPTFTIVAPRLFSAYSESVNPINLWVDGRQDDGQLRLDHARSFFEAARYPDDFHRAARPMSADNEAVVHAIHP
LEPGANVAGVNTYTVDRNAPRLDDKCGIFEYHVNTTLRTLYPNPRGNLLDAIRANIHYFYTSVQARGCTEIFPYG
RFEDGKNNAYYAYPDFPEVDLPEYGTFPFPPVDLPPYSDDLVPTSTAPASSAAASSAAASPEASMAVSEASMAAP
EASMAVPEASSA*
Coding >AgabiH97|065070
ATGGTTGGCTTCATCTCCTTCGTTGTGCTCGCAGTCGCTTTGGTCGCTCCCGCCGCCGCATTCCCAGCACATGGT
TCATTAGCTGGATTGTCGAGGCAAGAATTGGATGATGCCATGAGTGCCTTCGGCAAATACAAGAGACCGCCACCA
CCCCCTGGACCCCTCGAATATGGTGGTGTCAAGCTCGTCAACGATGCCGAACATCCTTTCAAGCCTCCGCGCAAA
GGTGATATCCGTGGTCCTTGCCCAGCTTTGAACACTCTCGCCAACCATGGTTACATCAGCCGCAACGGTATCGAG
TCACCCTCTAACATCGTCCGTGCCGCCATGGAAGGTTTCAACATGAACAACGACTTGGCCAAGTTCACCTGCTAC
GCTGCCTTCATTGTCAACGGAAACATGGTCACCGACTTGGTCAGTATCGGCGAAAAGTCCAAGAAGACTGGACCC
GACCCGAAAGATCAACCGGCGACTATTGGTGGTTTGAACACGCATAACGTGTTTGAGGGTGACAGCTCTATGACT
CGAGCTGATTTCTATGATGGTGGCGATGTCGAGAGCTTCAACGAGACCCTCTTCCAAGGATTCCTTGAATACAGC
TACAGATTCGGTGGTGGAAGGTACAACCTTACCGCTGCTGGCGAGTACCGCCTCAAGCGTACTCAAGACGGTATC
CAAAACAATCCCACCTTCACCATCGTCGCTCCCCGACTCTTCTCTGCTTACTCTGAATCCGTCAACCCCATCAAC
TTGTGGGTAGATGGACGCCAAGACGATGGACAACTCAGGCTCGACCATGCCCGCAGCTTCTTTGAGGCCGCCCGT
TATCCCGATGACTTCCACCGGGCTGCACGCCCCATGAGCGCTGATAACGAGGCCGTCGTGCATGCTATCCATCCC
CTTGAGCCAGGAGCCAACGTCGCAGGAGTTAACACTTACACTGTGGACCGTAATGCACCCAGACTTGACGACAAG
TGCGGTATCTTCGAGTACCACGTCAACACCACTCTGCGCACACTCTACCCCAACCCGAGAGGCAACTTGTTGGAC
GCGATCAGGGCCAACATCCACTACTTCTACACCTCTGTCCAAGCTAGAGGTTGCACCGAAATCTTCCCCTACGGT
CGATTCGAGGATGGGAAAAACAATGCTTACTACGCGTACCCTGATTTCCCCGAGGTCGATCTCCCTGAATACGGA
ACTTTCCCCTTCCCCCCAGTCGACCTCCCTCCCTACTCTGACGACCTCGTCCCCACATCCACCGCCCCTGCATCC
AGCGCTGCCGCATCCAGCGCCGCGGCATCACCTGAAGCATCGATGGCGGTTTCTGAAGCATCGATGGCGGCTCCT
GAAGCATCGATGGCGGTTCCTGAAGCATCTAGCGCCTAA
Transcript >AgabiH97|065070
ATGGTTGGCTTCATCTCCTTCGTTGTGCTCGCAGTCGCTTTGGTCGCTCCCGCCGCCGCATTCCCAGCACATGGT
TCATTAGCTGGATTGTCGAGGCAAGAATTGGATGATGCCATGAGTGCCTTCGGCAAATACAAGAGACCGCCACCA
CCCCCTGGACCCCTCGAATATGGTGGTGTCAAGCTCGTCAACGATGCCGAACATCCTTTCAAGCCTCCGCGCAAA
GGTGATATCCGTGGTCCTTGCCCAGCTTTGAACACTCTCGCCAACCATGGTTACATCAGCCGCAACGGTATCGAG
TCACCCTCTAACATCGTCCGTGCCGCCATGGAAGGTTTCAACATGAACAACGACTTGGCCAAGTTCACCTGCTAC
GCTGCCTTCATTGTCAACGGAAACATGGTCACCGACTTGGTCAGTATCGGCGAAAAGTCCAAGAAGACTGGACCC
GACCCGAAAGATCAACCGGCGACTATTGGTGGTTTGAACACGCATAACGTGTTTGAGGGTGACAGCTCTATGACT
CGAGCTGATTTCTATGATGGTGGCGATGTCGAGAGCTTCAACGAGACCCTCTTCCAAGGATTCCTTGAATACAGC
TACAGATTCGGTGGTGGAAGGTACAACCTTACCGCTGCTGGCGAGTACCGCCTCAAGCGTACTCAAGACGGTATC
CAAAACAATCCCACCTTCACCATCGTCGCTCCCCGACTCTTCTCTGCTTACTCTGAATCCGTCAACCCCATCAAC
TTGTGGGTAGATGGACGCCAAGACGATGGACAACTCAGGCTCGACCATGCCCGCAGCTTCTTTGAGGCCGCCCGT
TATCCCGATGACTTCCACCGGGCTGCACGCCCCATGAGCGCTGATAACGAGGCCGTCGTGCATGCTATCCATCCC
CTTGAGCCAGGAGCCAACGTCGCAGGAGTTAACACTTACACTGTGGACCGTAATGCACCCAGACTTGACGACAAG
TGCGGTATCTTCGAGTACCACGTCAACACCACTCTGCGCACACTCTACCCCAACCCGAGAGGCAACTTGTTGGAC
GCGATCAGGGCCAACATCCACTACTTCTACACCTCTGTCCAAGCTAGAGGTTGCACCGAAATCTTCCCCTACGGT
CGATTCGAGGATGGGAAAAACAATGCTTACTACGCGTACCCTGATTTCCCCGAGGTCGATCTCCCTGAATACGGA
ACTTTCCCCTTCCCCCCAGTCGACCTCCCTCCCTACTCTGACGACCTCGTCCCCACATCCACCGCCCCTGCATCC
AGCGCTGCCGCATCCAGCGCCGCGGCATCACCTGAAGCATCGATGGCGGTTTCTGAAGCATCGATGGCGGCTCCT
GAAGCATCGATGGCGGTTCCTGAAGCATCTAGCGCCTAA
Gene >AgabiH97|065070
ATGGTTGGCTTCATCTCCTTCGTTGTGCTCGCAGTCGCTTTGGTCGCTCCCGCCGCCGCATTCCCAGCACATGGT
TCATTAGCTGGATTGTCGAGGCAAGAATTGGATGATGCCATGAGTGCCTTCGGCAAATACAAGAGACCGCCACCA
CCCCCTGGACCCCTCGAATATGGTGGTGTCAAGCTCGTCAACGATGCCGAACATCCTTTCAAGCCTCCGCGCAAA
GGTGATATCCGTGGTCCTTGCCCAGCTTTGAACACTCTCGCCAACCATGGTGTACGTACCATTCTTCGACCTTGC
TTCTCGCTTTAACATCTGACCCAATTCACAGTACATCAGCCGCAACGGTATCGAGTCACCCTCTAACATCGTCCG
TGCCGCCATGGAAGGTCAGTGCTTCAGCTTTTCCTTCACGGTCATTCGCTGACCTTGCGCAGGTTTCAACATGAA
CAACGACTTGGCCAAGTTCACCTGCTACGCTGCCTTCATTGTCAACGGAAACATGGTCACCGACTTGGTCAGTAT
CGGCGAAAAGTCCAAGAAGACTGGACCCGACCCGAAAGATCAACCGGCGACTATTGGTGGTTTGAACACGCATAA
CGTGTTTGAGGGTGACAGCTCTATGACTCGAGGTGAGTTTCGCGCATCGCCACACTATCCTAATCAAATGACTTA
CGTTGTCTCTAGCTGATTTCTATGATGGTGGCGATGTCGAGAGCTTCAACGAGACCCTCTTCCAAGGAGTATGTT
GTCCTGTATATTTTGAAGCTTCCAGGATCTGATCATTTCACAGTTCCTTGAATACAGCTACAGATTCGGTGGTGG
AAGGTACAACCTTACCGCTGCTGGCGAGTACCGCCTCAAGCGTACTCAAGACGGTATCCAAAACAATCCCACCTT
CACCATCGTCGCTCCCCGACTCTTCTCTGCTTACTCTGAATCCGTCAACCCCATCAACTTGTGGGTAGATGGACG
CCAAGACGATGGACAACTCAGGCTCGACCATGCCCGCAGCTTCTTTGAGGCCGCCCGTTATCCCGATGACTTCCA
CCGGGCTGCACGCCCCATGAGCGCTGATAACGAGGCCGTCGTGCATGCTATCCATCCCCTTGAGCCAGGAGCCAA
CGTCGCAGGAGTTAACACTTACACTGTGGACCGTAATGCACCCAGACTTGACGACAAGTGCGGTATCTTCGAGTA
CCACGTCAACACCACTCTGCGCACACTCTACCCCAACCCGAGAGGCAACTTGTTGGACGCGATCAGGGCCAACAT
CCACTACTTCTACACCTCTGTCCAAGCTAGAGGTTGCACCGAAATCTTCCCCTACGGTCGATTCGAGGATGGGAA
AAACAATGCTTACTACGCGTACCCTGATTTCCCCGAGGTCGATCTCCCTGAATACGGAACTTTCCCCTTCCCCCC
AGTCGACCTCCCTCCCTACTCTGACGACCTCGTCCCCACATCCACCGCCCCTGCATCCAGCGCTGCCGCATCCAG
CGCCGCGGCATCACCTGAAGCATCGATGGCGGTTTCTGAAGCATCGATGGCGGCTCCTGAAGCATCGATGGCGGT
TCCTGAAGCATCTAGCGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail