© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|065020 |
| Gene name | |
| Location | scaffold_3:3003078..3004687 |
| Strand | + |
| Gene length (bp) | 1609 |
| Transcript length (bp) | 1083 |
| Coding sequence length (bp) | 1083 |
| Protein length (aa) | 361 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF08240 | ADH_N | Alcohol dehydrogenase GroES-like domain | 1.2E-25 | 40 | 151 |
| PF00107 | ADH_zinc_N | Zinc-binding dehydrogenase | 1.3E-23 | 194 | 324 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q9P6C8|ADH1_NEUCR | Alcohol dehydrogenase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adh-1 PE=3 SV=1 | 4 | 358 | 7.0E-89 |
| sp|P07754|ADH3_EMENI | Alcohol dehydrogenase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcC PE=3 SV=1 | 5 | 360 | 1.0E-86 |
| sp|P49385|ADH4_KLULA | Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 | 1 | 358 | 3.0E-84 |
| sp|O94038|ADH2_CANAL | Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 | 5 | 358 | 7.0E-84 |
| sp|P07246|ADH3_YEAST | Alcohol dehydrogenase 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH3 PE=1 SV=2 | 1 | 358 | 9.0E-83 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q9P6C8|ADH1_NEUCR | Alcohol dehydrogenase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adh-1 PE=3 SV=1 | 4 | 358 | 7.0E-89 |
| sp|P07754|ADH3_EMENI | Alcohol dehydrogenase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcC PE=3 SV=1 | 5 | 360 | 1.0E-86 |
| sp|P49385|ADH4_KLULA | Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 | 1 | 358 | 3.0E-84 |
| sp|O94038|ADH2_CANAL | Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 | 5 | 358 | 7.0E-84 |
| sp|P07246|ADH3_YEAST | Alcohol dehydrogenase 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH3 PE=1 SV=2 | 1 | 358 | 9.0E-83 |
| sp|P49384|ADH3_KLULA | Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 | 7 | 358 | 1.0E-81 |
| sp|P41747|ADH1_ASPFN | Alcohol dehydrogenase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=adh1 PE=2 SV=2 | 5 | 360 | 1.0E-81 |
| sp|P43067|ADH1_CANAX | Alcohol dehydrogenase 1 OS=Candida albicans GN=ADH1 PE=1 SV=1 | 6 | 358 | 2.0E-80 |
| sp|O13309|ADH2_PICST | Alcohol dehydrogenase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH2 PE=3 SV=1 | 5 | 358 | 4.0E-80 |
| sp|P00331|ADH2_YEAST | Alcohol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH2 PE=1 SV=3 | 5 | 358 | 7.0E-80 |
| sp|P42327|ADH2_GEOSE | Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 | 12 | 360 | 7.0E-80 |
| sp|P08843|ADH1_EMENI | Alcohol dehydrogenase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcA PE=3 SV=2 | 5 | 360 | 3.0E-79 |
| sp|O00097|ADH1_PICST | Alcohol dehydrogenase 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH1 PE=3 SV=1 | 5 | 358 | 8.0E-77 |
| sp|P00330|ADH1_YEAST | Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH1 PE=1 SV=5 | 5 | 358 | 2.0E-76 |
| sp|P20369|ADH1_KLULA | Alcohol dehydrogenase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH1 PE=3 SV=1 | 7 | 358 | 3.0E-76 |
| sp|Q07288|ADH1_KLUMA | Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1 | 7 | 358 | 2.0E-75 |
| sp|O31186|ADHA_RHIME | Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 | 10 | 360 | 1.0E-74 |
| sp|P49383|ADH2_KLULA | Alcohol dehydrogenase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH2 PE=3 SV=2 | 5 | 358 | 2.0E-74 |
| sp|Q9P4C2|ADH2_KLUMA | Alcohol dehydrogenase 2 OS=Kluyveromyces marxianus GN=ADH2 PE=3 SV=3 | 5 | 358 | 4.0E-74 |
| sp|P38113|ADH5_YEAST | Alcohol dehydrogenase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH5 PE=1 SV=1 | 7 | 359 | 1.0E-73 |
| sp|Q6XQ67|ADH5_SACPS | Alcohol dehydrogenase 5 OS=Saccharomyces pastorianus GN=ADH5 PE=3 SV=1 | 7 | 359 | 1.0E-73 |
| sp|P12311|ADH1_GEOSE | Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 | 12 | 360 | 1.0E-72 |
| sp|F2Z678|ADH2_YARLI | Alcohol dehydrogenase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADH2 PE=1 SV=1 | 7 | 358 | 5.0E-72 |
| sp|P42328|ADH3_GEOSE | Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 | 12 | 360 | 3.0E-71 |
| sp|P54202|ADH2_EMENI | Alcohol dehydrogenase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcB PE=3 SV=2 | 6 | 360 | 1.0E-68 |
| sp|P00332|ADH_SCHPO | Alcohol dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adh1 PE=1 SV=2 | 7 | 360 | 2.0E-68 |
| sp|Q8NXU1|ADH_STAAW | Alcohol dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=adh PE=3 SV=1 | 37 | 360 | 2.0E-66 |
| sp|Q6GBM4|ADH_STAAS | Alcohol dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=adh PE=3 SV=1 | 37 | 360 | 2.0E-66 |
| sp|Q6GJ63|ADH_STAAR | Alcohol dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=adh PE=3 SV=1 | 37 | 360 | 2.0E-66 |
| sp|Q5HI63|ADH_STAAC | Alcohol dehydrogenase OS=Staphylococcus aureus (strain COL) GN=adh PE=3 SV=1 | 37 | 360 | 2.0E-66 |
| sp|Q2YSX0|ADH_STAAB | Alcohol dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=adh PE=3 SV=1 | 37 | 360 | 2.0E-66 |
| sp|Q2G0G1|ADH_STAA8 | Alcohol dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=adh PE=3 SV=1 | 37 | 360 | 2.0E-66 |
| sp|Q2FJ31|ADH_STAA3 | Alcohol dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=adh PE=3 SV=1 | 37 | 360 | 2.0E-66 |
| sp|Q7A742|ADH_STAAN | Alcohol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=adh PE=1 SV=1 | 37 | 360 | 2.0E-66 |
| sp|Q99W07|ADH_STAAM | Alcohol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adh PE=3 SV=1 | 37 | 360 | 2.0E-66 |
| sp|Q5HRD6|ADH_STAEQ | Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adh PE=3 SV=1 | 35 | 360 | 2.0E-61 |
| sp|Q8CQ56|ADH_STAES | Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adh PE=3 SV=1 | 35 | 360 | 3.0E-61 |
| sp|Q17334|ADH1_CAEEL | Alcohol dehydrogenase 1 OS=Caenorhabditis elegans GN=sodh-1 PE=2 SV=2 | 6 | 360 | 3.0E-59 |
| sp|O45687|ADH2_CAEEL | Alcohol dehydrogenase 2 OS=Caenorhabditis elegans GN=sodh-2 PE=3 SV=1 | 3 | 358 | 1.0E-57 |
| sp|P20368|ADH1_ZYMMO | Alcohol dehydrogenase 1 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=adhA PE=1 SV=2 | 32 | 358 | 2.0E-56 |
| sp|P39451|ADHP_ECOLI | Alcohol dehydrogenase, propanol-preferring OS=Escherichia coli (strain K12) GN=adhP PE=1 SV=1 | 37 | 360 | 3.0E-53 |
| sp|Q4J781|ADH_SULAC | NAD-dependent alcohol dehydrogenase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=adh PE=3 SV=1 | 40 | 360 | 8.0E-36 |
| sp|P27250|AHR_ECOLI | Aldehyde reductase Ahr OS=Escherichia coli (strain K12) GN=ahr PE=1 SV=2 | 34 | 359 | 5.0E-34 |
| sp|O82035|CADH2_PICAB | Probable cinnamyl alcohol dehydrogenase 2 OS=Picea abies GN=CAD2 PE=3 SV=1 | 39 | 360 | 6.0E-34 |
| sp|Q08350|CADH7_PICAB | Probable cinnamyl alcohol dehydrogenase 7/8 OS=Picea abies GN=CAD7 PE=2 SV=1 | 39 | 360 | 7.0E-34 |
| sp|C0SPA5|ADHA_BACSU | Probable formaldehyde dehydrogenase AdhA OS=Bacillus subtilis (strain 168) GN=adhA PE=2 SV=1 | 37 | 360 | 8.0E-34 |
| sp|Q02971|CADH7_ARATH | Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis thaliana GN=CAD7 PE=1 SV=2 | 45 | 360 | 3.0E-32 |
| sp|Q40976|CADH_PINRA | Probable cinnamyl alcohol dehydrogenase OS=Pinus radiata GN=CAD PE=2 SV=1 | 39 | 360 | 4.0E-32 |
| sp|P31656|CADH_MEDSA | Probable cinnamyl alcohol dehydrogenase OS=Medicago sativa GN=CAD2 PE=1 SV=1 | 39 | 360 | 2.0E-30 |
| sp|P0CH37|ADHC2_MYCS2 | NADP-dependent alcohol dehydrogenase C 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhC2 PE=1 SV=1 | 39 | 359 | 2.0E-30 |
| sp|P0CH36|ADHC1_MYCS2 | NADP-dependent alcohol dehydrogenase C 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhc1 PE=1 SV=1 | 39 | 359 | 2.0E-30 |
| sp|Q9ZRF1|MTDH_FRAAN | Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1 | 45 | 360 | 2.0E-30 |
| sp|Q9SJ25|CADH2_ARATH | Cinnamyl alcohol dehydrogenase 2 OS=Arabidopsis thaliana GN=CAD2 PE=1 SV=1 | 44 | 360 | 5.0E-29 |
| sp|Q2KNL6|GEDH1_OCIBA | Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GEDH1 PE=1 SV=1 | 45 | 360 | 7.0E-29 |
| sp|Q9SJ10|CADH3_ARATH | Cinnamyl alcohol dehydrogenase 3 OS=Arabidopsis thaliana GN=CAD3 PE=1 SV=1 | 44 | 360 | 8.0E-29 |
| sp|Q7XWU3|CADH6_ORYSJ | Probable cinnamyl alcohol dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CAD6 PE=2 SV=2 | 44 | 360 | 2.0E-28 |
| sp|P9WQC5|ADHC_MYCTU | NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhC PE=1 SV=1 | 39 | 360 | 2.0E-28 |
| sp|P9WQC4|ADHC_MYCTO | NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhC PE=3 SV=1 | 39 | 360 | 2.0E-28 |
| sp|P0A4X1|ADHC_MYCBO | NADP-dependent alcohol dehydrogenase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhC PE=3 SV=1 | 39 | 360 | 2.0E-28 |
| sp|P31655|CADH2_EUCGU | Probable cinnamyl alcohol dehydrogenase 2 OS=Eucalyptus gunnii GN=CAD2 PE=2 SV=1 | 39 | 360 | 3.0E-28 |
| sp|O64969|CADH_EUCGL | Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus globulus GN=CAD PE=2 SV=1 | 39 | 360 | 4.0E-28 |
| sp|Q337Y2|CADH3_ORYSJ | Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CAD3 PE=2 SV=1 | 44 | 360 | 7.0E-28 |
| sp|Q42726|CADH1_EUCGU | Probable cinnamyl alcohol dehydrogenase 1 OS=Eucalyptus gunnii GN=CAD1 PE=3 SV=1 | 39 | 360 | 9.0E-28 |
| sp|P42734|CADH9_ARATH | Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana GN=CAD9 PE=2 SV=2 | 44 | 360 | 1.0E-27 |
| sp|P93257|MTDH_MESCR | Probable mannitol dehydrogenase OS=Mesembryanthemum crystallinum GN=ELI3 PE=2 SV=1 | 45 | 360 | 2.0E-27 |
| sp|A4YGN0|SUCD_METS5 | Succinate-semialdehyde dehydrogenase (acetylating) OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1424 PE=1 SV=1 | 12 | 358 | 2.0E-27 |
| sp|Q6ERW9|CAD8B_ORYSJ | Probable cinnamyl alcohol dehydrogenase 8B OS=Oryza sativa subsp. japonica GN=CAD8B PE=3 SV=2 | 38 | 360 | 3.0E-27 |
| sp|O82515|MTDH_MEDSA | Probable mannitol dehydrogenase OS=Medicago sativa GN=CAD1 PE=1 SV=1 | 44 | 360 | 3.0E-27 |
| sp|Q96XE0|ADH_SULTO | NAD-dependent alcohol dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=adh PE=1 SV=1 | 12 | 358 | 9.0E-27 |
| sp|Q38707|MTDH_APIGR | Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1 | 44 | 360 | 2.0E-26 |
| sp|P30360|CADH2_TOBAC | Probable cinnamyl alcohol dehydrogenase 2 OS=Nicotiana tabacum GN=CAD19 PE=1 SV=1 | 39 | 360 | 3.0E-26 |
| sp|Q10PS6|CADH9_ORYSJ | Probable cinnamyl alcohol dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CAD9 PE=2 SV=1 | 30 | 360 | 3.0E-26 |
| sp|Q43137|MTDH1_STYHU | Probable mannitol dehydrogenase 1 OS=Stylosanthes humilis GN=CAD1 PE=2 SV=1 | 44 | 360 | 3.0E-26 |
| sp|P25377|ADH7_YEAST | NADP-dependent alcohol dehydrogenase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH7 PE=1 SV=1 | 44 | 358 | 4.0E-26 |
| sp|P75691|YAHK_ECOLI | Aldehyde reductase YahK OS=Escherichia coli (strain K12) GN=yahK PE=1 SV=1 | 38 | 358 | 8.0E-26 |
| sp|Q02972|CADH8_ARATH | Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis thaliana GN=CAD8 PE=1 SV=1 | 45 | 360 | 9.0E-26 |
| sp|Q0JA75|CADH7_ORYSJ | Cinnamyl alcohol dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CAD7 PE=2 SV=1 | 44 | 360 | 9.0E-26 |
| sp|Q6ERW7|CAD8C_ORYSJ | Probable cinnamyl alcohol dehydrogenase 8C OS=Oryza sativa subsp. japonica GN=CAD8C PE=2 SV=2 | 38 | 360 | 1.0E-25 |
| sp|O65621|CADH6_ARATH | Probable cinnamyl alcohol dehydrogenase 6 OS=Arabidopsis thaliana GN=CAD6 PE=2 SV=1 | 44 | 360 | 3.0E-25 |
| sp|P41637|CADH_PINTA | Probable cinnamyl alcohol dehydrogenase OS=Pinus taeda PE=2 SV=1 | 39 | 360 | 3.0E-25 |
| sp|Q0J6T3|CADH5_ORYSJ | Putative cinnamyl alcohol dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=CAD5 PE=3 SV=2 | 43 | 360 | 7.0E-25 |
| sp|Q6ERX1|CAD8A_ORYSJ | Probable cinnamyl alcohol dehydrogenase 8A OS=Oryza sativa subsp. japonica GN=CAD8A PE=2 SV=1 | 44 | 360 | 1.0E-24 |
| sp|P42754|MTDH_PETCR | Mannitol dehydrogenase (Fragment) OS=Petroselinum crispum GN=ELI3 PE=2 SV=1 | 45 | 360 | 2.0E-24 |
| sp|Q8H859|CADH1_ORYSJ | Probable cinnamyl alcohol dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=CAD1 PE=2 SV=1 | 44 | 360 | 2.0E-24 |
| sp|P50746|CADH_EUCBO | Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus botryoides GN=CAD1 PE=3 SV=1 | 39 | 360 | 4.0E-24 |
| sp|Q975C8|ACAR_SULTO | Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 | 38 | 359 | 5.0E-24 |
| sp|P42495|CADH1_ARACO | Probable cinnamyl alcohol dehydrogenase 1 OS=Aralia cordata GN=CAD1 PE=2 SV=1 | 36 | 360 | 8.0E-24 |
| sp|Q6ERW5|CAD8D_ORYSJ | Probable cinnamyl alcohol dehydrogenase 8D OS=Oryza sativa subsp. japonica GN=CAD8D PE=2 SV=1 | 24 | 360 | 2.0E-23 |
| sp|P30359|CADH1_TOBAC | Probable cinnamyl alcohol dehydrogenase 1 OS=Nicotiana tabacum GN=CAD14 PE=1 SV=1 | 39 | 360 | 2.0E-23 |
| sp|Q6V4H0|10HGO_CATRO | 8-hydroxygeraniol dehydrogenase OS=Catharanthus roseus GN=10HGO PE=1 SV=1 | 45 | 360 | 3.0E-23 |
| sp|Q2KNL5|CADH1_OCIBA | Cinnamyl alcohol dehydrogenase 1 OS=Ocimum basilicum GN=CAD1 PE=1 SV=1 | 39 | 360 | 6.0E-22 |
| sp|P48523|CADH4_ARATH | Cinnamyl alcohol dehydrogenase 4 OS=Arabidopsis thaliana GN=CAD4 PE=1 SV=1 | 44 | 360 | 1.0E-21 |
| sp|P31657|CADH_POPDE | Probable cinnamyl alcohol dehydrogenase OS=Populus deltoides PE=2 SV=2 | 39 | 360 | 1.0E-21 |
| sp|Q2R114|CADH4_ORYSJ | Putative cinnamyl alcohol dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CAD4 PE=3 SV=2 | 36 | 360 | 3.0E-21 |
| sp|A4YGN2|ACAR_METS5 | Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 | 29 | 358 | 3.0E-21 |
| sp|Q9CAI3|CADH1_ARATH | Probable cinnamyl alcohol dehydrogenase 1 OS=Arabidopsis thaliana GN=CAD1 PE=2 SV=1 | 46 | 360 | 4.0E-21 |
| sp|P73138|FRMA_SYNY3 | S-(hydroxymethyl)glutathione dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=frmA PE=3 SV=1 | 12 | 357 | 7.0E-21 |
| sp|H1ZV38|GEOA_CASDE | Geraniol dehydrogenase OS=Castellaniella defragrans GN=geoA PE=1 SV=1 | 10 | 300 | 9.0E-21 |
| sp|A3QJC8|TDH_SHELP | L-threonine 3-dehydrogenase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-20 |
| sp|P80094|FADH_AMYME | S-(hydroxymethyl)mycothiol dehydrogenase OS=Amycolatopsis methanolica PE=1 SV=2 | 39 | 358 | 3.0E-20 |
| sp|Q0HPI5|TDH_SHESR | L-threonine 3-dehydrogenase OS=Shewanella sp. (strain MR-7) GN=tdh PE=3 SV=1 | 29 | 358 | 5.0E-20 |
| sp|Q0HDA3|TDH_SHESM | L-threonine 3-dehydrogenase OS=Shewanella sp. (strain MR-4) GN=tdh PE=3 SV=1 | 29 | 358 | 6.0E-20 |
| sp|A0L2Q3|TDH_SHESA | L-threonine 3-dehydrogenase OS=Shewanella sp. (strain ANA-3) GN=tdh PE=3 SV=1 | 29 | 358 | 6.0E-20 |
| sp|A1S1Q3|TDH_SHEAM | L-threonine 3-dehydrogenase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tdh PE=3 SV=1 | 29 | 358 | 7.0E-20 |
| sp|Q43138|MTDH3_STYHU | Probable mannitol dehydrogenase 3 OS=Stylosanthes humilis GN=CAD3 PE=2 SV=1 | 48 | 360 | 9.0E-20 |
| sp|A4YCC5|TDH_SHEPC | L-threonine 3-dehydrogenase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-19 |
| sp|Q15ZU4|TDH_PSEA6 | L-threonine 3-dehydrogenase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tdh PE=3 SV=1 | 14 | 307 | 1.0E-19 |
| sp|B1KL24|TDH_SHEWM | L-threonine 3-dehydrogenase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tdh PE=3 SV=1 | 29 | 359 | 1.0E-19 |
| sp|P9WQC1|ADHA_MYCTU | Probable alcohol dehydrogenase AdhA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhA PE=1 SV=1 | 39 | 360 | 1.0E-19 |
| sp|P9WQC0|ADHA_MYCTO | Probable alcohol dehydrogenase AdhA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhA PE=3 SV=1 | 39 | 360 | 1.0E-19 |
| sp|Q8E8J1|TDH_SHEON | L-threonine 3-dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=tdh PE=3 SV=1 | 29 | 358 | 4.0E-19 |
| sp|P59410|TDH_VIBPA | L-threonine 3-dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tdh PE=3 SV=1 | 31 | 358 | 4.0E-19 |
| sp|A9KWY0|TDH_SHEB9 | L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS195) GN=tdh PE=3 SV=1 | 16 | 358 | 4.0E-19 |
| sp|A3CYN0|TDH_SHEB5 | L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tdh PE=3 SV=1 | 16 | 358 | 4.0E-19 |
| sp|B8EDS6|TDH_SHEB2 | L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS223) GN=tdh PE=3 SV=1 | 16 | 358 | 4.0E-19 |
| sp|B7VR52|TDH_VIBTL | L-threonine 3-dehydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=tdh PE=3 SV=1 | 9 | 358 | 4.0E-19 |
| sp|A6WUG6|TDH_SHEB8 | L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS185) GN=tdh PE=3 SV=1 | 16 | 358 | 6.0E-19 |
| sp|P9WQB9|ADHD_MYCTU | Putative alcohol dehydrogenase D OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhD PE=1 SV=1 | 13 | 357 | 6.0E-19 |
| sp|P9WQB8|ADHD_MYCTO | Putative alcohol dehydrogenase D OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhD PE=3 SV=1 | 13 | 357 | 6.0E-19 |
| sp|B6ESA4|TDH_ALISL | L-threonine 3-dehydrogenase OS=Aliivibrio salmonicida (strain LFI1238) GN=tdh PE=3 SV=1 | 9 | 358 | 7.0E-19 |
| sp|O74685|FADH_PICPA | S-(hydroxymethyl)glutathione dehydrogenase OS=Komagataella pastoris GN=FLD1 PE=3 SV=1 | 1 | 357 | 8.0E-19 |
| sp|P80175|ADHN_AMYME | NDMA-dependent alcohol dehydrogenase OS=Amycolatopsis methanolica PE=1 SV=2 | 12 | 358 | 8.0E-19 |
| sp|A1RE07|TDH_SHESW | L-threonine 3-dehydrogenase OS=Shewanella sp. (strain W3-18-1) GN=tdh PE=3 SV=1 | 16 | 358 | 9.0E-19 |
| sp|A8GYP8|TDH_SHEPA | L-threonine 3-dehydrogenase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tdh PE=3 SV=1 | 29 | 359 | 1.0E-18 |
| sp|C5FTT1|XYL2_ARTOC | Probable D-xylulose reductase A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=xdhA PE=3 SV=1 | 43 | 351 | 1.0E-18 |
| sp|B0TNM4|TDH_SHEHH | L-threonine 3-dehydrogenase OS=Shewanella halifaxensis (strain HAW-EB4) GN=tdh PE=3 SV=1 | 29 | 359 | 1.0E-18 |
| sp|P50381|ADH_SULSR | NAD-dependent alcohol dehydrogenase OS=Sulfolobus sp. (strain RC3) GN=adh PE=3 SV=1 | 38 | 358 | 2.0E-18 |
| sp|B5ETJ6|TDH_VIBFM | L-threonine 3-dehydrogenase OS=Vibrio fischeri (strain MJ11) GN=tdh PE=3 SV=1 | 9 | 358 | 2.0E-18 |
| sp|Q48AM4|TDH_COLP3 | L-threonine 3-dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=tdh PE=3 SV=1 | 32 | 358 | 2.0E-18 |
| sp|Q7NXH5|TDH_CHRVO | L-threonine 3-dehydrogenase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tdh PE=3 SV=1 | 36 | 307 | 3.0E-18 |
| sp|A4SHB7|TDH_AERS4 | L-threonine 3-dehydrogenase OS=Aeromonas salmonicida (strain A449) GN=tdh PE=3 SV=1 | 36 | 358 | 6.0E-18 |
| sp|Q7MY48|TDH_PHOLL | L-threonine 3-dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tdh PE=3 SV=1 | 29 | 359 | 6.0E-18 |
| sp|Q5E0F9|TDH_VIBF1 | L-threonine 3-dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=tdh PE=3 SV=1 | 9 | 358 | 7.0E-18 |
| sp|P78870|FADH1_SCHPO | Probable S-(hydroxymethyl)glutathione dehydrogenase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1539.07c PE=2 SV=2 | 10 | 351 | 7.0E-18 |
| sp|C6DIA7|TDH_PECCP | L-threonine 3-dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=tdh PE=3 SV=1 | 29 | 307 | 1.0E-17 |
| sp|Q8ZL52|TDH_SALTY | L-threonine 3-dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-17 |
| sp|B4TZV9|TDH_SALSV | L-threonine 3-dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-17 |
| sp|B5BHZ1|TDH_SALPK | L-threonine 3-dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-17 |
| sp|C0Q1V0|TDH_SALPC | L-threonine 3-dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-17 |
| sp|A9MVL0|TDH_SALPB | L-threonine 3-dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-17 |
| sp|Q5PC07|TDH_SALPA | L-threonine 3-dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-17 |
| sp|B4SXB9|TDH_SALNS | L-threonine 3-dehydrogenase OS=Salmonella newport (strain SL254) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-17 |
| sp|B4T9A1|TDH_SALHS | L-threonine 3-dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-17 |
| sp|B5R5E1|TDH_SALEP | L-threonine 3-dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-17 |
| sp|B5FLI6|TDH_SALDC | L-threonine 3-dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-17 |
| sp|Q57IC5|TDH_SALCH | L-threonine 3-dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-17 |
| sp|B5EXC3|TDH_SALA4 | L-threonine 3-dehydrogenase OS=Salmonella agona (strain SL483) GN=tdh PE=3 SV=1 | 29 | 358 | 1.0E-17 |
| sp|B7LVH6|TDH_ESCF3 | L-threonine 3-dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=tdh PE=3 SV=1 | 29 | 358 | 2.0E-17 |
| sp|Q3YVY1|TDH_SHISS | L-threonine 3-dehydrogenase OS=Shigella sonnei (strain Ss046) GN=tdh PE=3 SV=1 | 36 | 358 | 2.0E-17 |
| sp|B4S298|TDH_ALTMD | L-threonine 3-dehydrogenase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tdh PE=3 SV=1 | 36 | 358 | 2.0E-17 |
| sp|B5RGH0|TDH_SALG2 | L-threonine 3-dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=tdh PE=3 SV=1 | 29 | 358 | 2.0E-17 |
| sp|A9MKQ8|TDH_SALAR | L-threonine 3-dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=tdh PE=3 SV=1 | 29 | 359 | 3.0E-17 |
| sp|Q07W50|TDH_SHEFN | L-threonine 3-dehydrogenase OS=Shewanella frigidimarina (strain NCIMB 400) GN=tdh PE=3 SV=1 | 29 | 359 | 3.0E-17 |
| sp|Q6DAT5|TDH_PECAS | L-threonine 3-dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tdh PE=3 SV=1 | 29 | 307 | 3.0E-17 |
| sp|Q9Z9U1|DHSO_BACHD | Sorbitol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gutB PE=3 SV=1 | 26 | 329 | 3.0E-17 |
| sp|B7NES3|TDH_ECOLU | L-threonine 3-dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=tdh PE=3 SV=1 | 36 | 358 | 4.0E-17 |
| sp|P59409|TDH_SHIFL | L-threonine 3-dehydrogenase OS=Shigella flexneri GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|Q0SYE5|TDH_SHIF8 | L-threonine 3-dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|Q31V06|TDH_SHIBS | L-threonine 3-dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|B2U5D5|TDH_SHIB3 | L-threonine 3-dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|B6I3J6|TDH_ECOSE | L-threonine 3-dehydrogenase OS=Escherichia coli (strain SE11) GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|B1IZH4|TDH_ECOLC | L-threonine 3-dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|Q0TBJ0|TDH_ECOL5 | L-threonine 3-dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|A8A681|TDH_ECOHS | L-threonine 3-dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|B7M4A3|TDH_ECO8A | L-threonine 3-dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|B7L742|TDH_ECO55 | L-threonine 3-dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|C3LWF0|TDH_VIBCM | L-threonine 3-dehydrogenase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|Q9KL62|TDH_VIBCH | L-threonine 3-dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|A5F0N6|TDH_VIBC3 | L-threonine 3-dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tdh PE=3 SV=1 | 36 | 358 | 5.0E-17 |
| sp|Q8R7K0|TDH_CALS4 | L-threonine 3-dehydrogenase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tdh PE=3 SV=2 | 17 | 314 | 6.0E-17 |
| sp|Q8D442|TDH_VIBVU | L-threonine 3-dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=tdh PE=3 SV=1 | 9 | 358 | 6.0E-17 |
| sp|P39462|ADH_SULSO | NAD-dependent alcohol dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=adh PE=1 SV=1 | 41 | 358 | 6.0E-17 |
| sp|Q04894|ADH6_YEAST | NADP-dependent alcohol dehydrogenase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH6 PE=1 SV=1 | 44 | 358 | 7.0E-17 |
| sp|Q8Z2F4|TDH_SALTI | L-threonine 3-dehydrogenase OS=Salmonella typhi GN=tdh PE=3 SV=1 | 29 | 358 | 8.0E-17 |
| sp|P39849|XYLB_PSEPU | Aryl-alcohol dehydrogenase OS=Pseudomonas putida GN=xylB PE=1 SV=1 | 12 | 301 | 8.0E-17 |
| sp|P07913|TDH_ECOLI | L-threonine 3-dehydrogenase OS=Escherichia coli (strain K12) GN=tdh PE=1 SV=1 | 36 | 358 | 9.0E-17 |
| sp|B1X950|TDH_ECODH | L-threonine 3-dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=tdh PE=3 SV=1 | 36 | 358 | 9.0E-17 |
| sp|C4ZXK8|TDH_ECOBW | L-threonine 3-dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=tdh PE=3 SV=1 | 36 | 358 | 9.0E-17 |
| sp|Q1R4X4|TDH_ECOUT | L-threonine 3-dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=tdh PE=3 SV=1 | 36 | 358 | 1.0E-16 |
| sp|B1LK55|TDH_ECOSM | L-threonine 3-dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=tdh PE=3 SV=1 | 36 | 358 | 1.0E-16 |
| sp|Q8FCA2|TDH_ECOL6 | L-threonine 3-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tdh PE=3 SV=1 | 36 | 358 | 1.0E-16 |
| sp|A1AHF3|TDH_ECOK1 | L-threonine 3-dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=tdh PE=3 SV=1 | 36 | 358 | 1.0E-16 |
| sp|B7N1S0|TDH_ECO81 | L-threonine 3-dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=tdh PE=3 SV=1 | 36 | 358 | 1.0E-16 |
| sp|B7NPC5|TDH_ECO7I | L-threonine 3-dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=tdh PE=3 SV=1 | 36 | 358 | 1.0E-16 |
| sp|B7MFI0|TDH_ECO45 | L-threonine 3-dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=tdh PE=3 SV=1 | 36 | 358 | 1.0E-16 |
| sp|B7ULH2|TDH_ECO27 | L-threonine 3-dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=tdh PE=3 SV=1 | 36 | 358 | 1.0E-16 |
| sp|B5XTI4|TDH_KLEP3 | L-threonine 3-dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=tdh PE=3 SV=1 | 29 | 307 | 1.0E-16 |
| sp|A6TFL2|TDH_KLEP7 | L-threonine 3-dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tdh PE=3 SV=1 | 29 | 307 | 1.0E-16 |
| sp|A1JHX8|TDH_YERE8 | L-threonine 3-dehydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tdh PE=3 SV=1 | 31 | 359 | 2.0E-16 |
| sp|A4W529|TDH_ENT38 | L-threonine 3-dehydrogenase OS=Enterobacter sp. (strain 638) GN=tdh PE=3 SV=1 | 29 | 358 | 2.0E-16 |
| sp|Q5ARL6|XYL2_EMENI | Probable D-xylulose reductase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xdhA PE=3 SV=1 | 1 | 351 | 2.0E-16 |
| sp|Q0BKV5|TDH_FRATO | L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tdh PE=3 SV=1 | 43 | 307 | 2.0E-16 |
| sp|Q2A282|TDH_FRATH | L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tdh PE=3 SV=1 | 43 | 307 | 2.0E-16 |
| sp|A7NDM9|TDH_FRATF | L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tdh PE=3 SV=1 | 43 | 307 | 2.0E-16 |
| sp|B5YWB7|TDH_ECO5E | L-threonine 3-dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=tdh PE=3 SV=1 | 36 | 358 | 2.0E-16 |
| sp|Q8XEJ1|TDH_ECO57 | L-threonine 3-dehydrogenase OS=Escherichia coli O157:H7 GN=tdh PE=3 SV=1 | 36 | 358 | 2.0E-16 |
| sp|A4IZ92|TDH_FRATW | L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=tdh PE=3 SV=1 | 43 | 307 | 2.0E-16 |
| sp|Q5NGW4|TDH_FRATT | L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tdh PE=3 SV=1 | 43 | 307 | 2.0E-16 |
| sp|Q14IB6|TDH_FRAT1 | L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tdh PE=3 SV=1 | 43 | 307 | 2.0E-16 |
| sp|Q02912|DHSO_BOMMO | Sorbitol dehydrogenase OS=Bombyx mori GN=SDH PE=2 SV=1 | 10 | 309 | 3.0E-16 |
| sp|Q7MFL5|TDH_VIBVY | L-threonine 3-dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=tdh PE=3 SV=1 | 9 | 358 | 3.0E-16 |
| sp|P9WQC7|ADHB_MYCTU | Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhB PE=1 SV=1 | 12 | 351 | 3.0E-16 |
| sp|P9WQC6|ADHB_MYCTO | Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhB PE=3 SV=1 | 12 | 351 | 3.0E-16 |
| sp|Q7U1B9|ADHB_MYCBO | Alcohol dehydrogenase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhB PE=3 SV=1 | 12 | 351 | 3.0E-16 |
| sp|A0Q5K3|TDH_FRATN | L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. novicida (strain U112) GN=tdh PE=3 SV=1 | 43 | 307 | 4.0E-16 |
| sp|O94564|YGD6_SCHPO | Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 | 34 | 360 | 4.0E-16 |
| sp|A8GLC6|TDH_SERP5 | L-threonine 3-dehydrogenase OS=Serratia proteamaculans (strain 568) GN=tdh PE=3 SV=1 | 31 | 307 | 5.0E-16 |
| sp|Q6LRD9|TDH_PHOPR | L-threonine 3-dehydrogenase OS=Photobacterium profundum GN=tdh PE=3 SV=2 | 31 | 358 | 5.0E-16 |
| sp|A8FPE0|TDH_SHESH | L-threonine 3-dehydrogenase OS=Shewanella sediminis (strain HAW-EB3) GN=tdh PE=3 SV=1 | 29 | 359 | 6.0E-16 |
| sp|Q3IHW0|TDH_PSEHT | L-threonine 3-dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tdh PE=3 SV=1 | 29 | 359 | 6.0E-16 |
| sp|A7ZTH0|TDH_ECO24 | L-threonine 3-dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tdh PE=3 SV=1 | 36 | 358 | 8.0E-16 |
| sp|B1JQW2|TDH_YERPY | L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tdh PE=3 SV=1 | 31 | 307 | 9.0E-16 |
| sp|Q66GC5|TDH_YERPS | L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tdh PE=3 SV=1 | 31 | 307 | 9.0E-16 |
| sp|B2JYP4|TDH_YERPB | L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tdh PE=3 SV=1 | 31 | 307 | 9.0E-16 |
| sp|A7FCU5|TDH_YERP3 | L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tdh PE=3 SV=1 | 31 | 307 | 9.0E-16 |
| sp|B2SDJ2|TDH_FRATM | L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=tdh PE=3 SV=1 | 43 | 307 | 9.0E-16 |
| sp|A4TSC6|TDH_YERPP | L-threonine 3-dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=tdh PE=3 SV=1 | 31 | 307 | 1.0E-15 |
| sp|Q1CD13|TDH_YERPN | L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tdh PE=3 SV=1 | 31 | 307 | 1.0E-15 |
| sp|A9R685|TDH_YERPG | L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tdh PE=3 SV=1 | 31 | 307 | 1.0E-15 |
| sp|Q8ZJN2|TDH_YERPE | L-threonine 3-dehydrogenase OS=Yersinia pestis GN=tdh PE=3 SV=1 | 31 | 307 | 1.0E-15 |
| sp|Q1C278|TDH_YERPA | L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tdh PE=3 SV=1 | 31 | 307 | 1.0E-15 |
| sp|Q5GN51|XYL2_ASPNG | D-xylulose reductase A OS=Aspergillus niger GN=xdhA PE=3 SV=1 | 31 | 351 | 1.0E-15 |
| sp|A2QY54|XYL2_ASPNC | Probable D-xylulose reductase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xdhA PE=3 SV=1 | 31 | 351 | 1.0E-15 |
| sp|Q8KQL2|ARPD_ENTAV | D-arabitol-phosphate dehydrogenase OS=Enterococcus avium PE=1 SV=1 | 36 | 329 | 1.0E-15 |
| sp|P40394|ADH7_HUMAN | Alcohol dehydrogenase class 4 mu/sigma chain OS=Homo sapiens GN=ADH7 PE=1 SV=2 | 12 | 321 | 1.0E-15 |
| sp|Q86ZV0|XYL2_ASPOR | D-xylulose reductase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xdhA PE=3 SV=2 | 8 | 351 | 1.0E-15 |
| sp|P32771|FADH_YEAST | S-(hydroxymethyl)glutathione dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFA1 PE=1 SV=1 | 13 | 359 | 2.0E-15 |
| sp|Q9SK86|ADHL1_ARATH | Alcohol dehydrogenase-like 1 OS=Arabidopsis thaliana GN=At1g22430 PE=2 SV=1 | 8 | 351 | 2.0E-15 |
| sp|A8ARK6|TDH_CITK8 | L-threonine 3-dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=tdh PE=3 SV=1 | 36 | 359 | 2.0E-15 |
| sp|A6W1W3|TDH_MARMS | L-threonine 3-dehydrogenase OS=Marinomonas sp. (strain MWYL1) GN=tdh PE=3 SV=1 | 29 | 307 | 2.0E-15 |
| sp|O49482|CADH5_ARATH | Cinnamyl alcohol dehydrogenase 5 OS=Arabidopsis thaliana GN=CAD5 PE=1 SV=1 | 36 | 360 | 2.0E-15 |
| sp|P80468|ADH4_STRCA | Alcohol dehydrogenase 4 OS=Struthio camelus GN=ADH4 PE=1 SV=1 | 12 | 358 | 2.0E-15 |
| sp|A0KQV6|TDH_AERHH | L-threonine 3-dehydrogenase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=tdh PE=3 SV=1 | 36 | 358 | 3.0E-15 |
| sp|Q329N8|TDH_SHIDS | L-threonine 3-dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tdh PE=3 SV=1 | 36 | 358 | 3.0E-15 |
| sp|P41681|ADH6_PERMA | Alcohol dehydrogenase 6 OS=Peromyscus maniculatus GN=ADH6 PE=2 SV=1 | 12 | 324 | 3.0E-15 |
| sp|Q0CWQ2|XYL2_ASPTN | Probable D-xylulose reductase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xdhA PE=3 SV=1 | 36 | 351 | 3.0E-15 |
| sp|A1SVW5|TDH_PSYIN | L-threonine 3-dehydrogenase OS=Psychromonas ingrahamii (strain 37) GN=tdh PE=3 SV=1 | 38 | 358 | 3.0E-15 |
| sp|Q5QUN8|TDH_IDILO | L-threonine 3-dehydrogenase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tdh PE=3 SV=1 | 16 | 359 | 3.0E-15 |
| sp|B4F134|TDH_PROMH | L-threonine 3-dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=tdh PE=3 SV=1 | 36 | 307 | 4.0E-15 |
| sp|P41680|ADH1_PERMA | Alcohol dehydrogenase 1 OS=Peromyscus maniculatus GN=ADH1 PE=2 SV=2 | 12 | 351 | 4.0E-15 |
| sp|P77539|YDJL_ECOLI | Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjL OS=Escherichia coli (strain K12) GN=ydjL PE=3 SV=1 | 39 | 329 | 4.0E-15 |
| sp|O22380|CADH_LOLPR | Probable cinnamyl alcohol dehydrogenase OS=Lolium perenne PE=2 SV=1 | 43 | 360 | 4.0E-15 |
| sp|Q4WAU7|XYL2_ASPFU | Probable D-xylulose reductase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xdhA PE=3 SV=2 | 36 | 351 | 4.0E-15 |
| sp|B0YC65|XYL2_ASPFC | Probable D-xylulose reductase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xdhA PE=3 SV=2 | 36 | 351 | 4.0E-15 |
| sp|C5BB99|TDH_EDWI9 | L-threonine 3-dehydrogenase OS=Edwardsiella ictaluri (strain 93-146) GN=tdh PE=3 SV=1 | 43 | 359 | 4.0E-15 |
| sp|Q57517|Y053_HAEIN | Uncharacterized zinc-type alcohol dehydrogenase-like protein HI_0053 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0053 PE=3 SV=1 | 36 | 347 | 6.0E-15 |
| sp|A1CFY8|XYL2_ASPCL | Probable D-xylulose reductase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xdhA PE=3 SV=2 | 34 | 351 | 6.0E-15 |
| sp|A7MID0|TDH_CROS8 | L-threonine 3-dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tdh PE=3 SV=1 | 29 | 358 | 7.0E-15 |
| sp|B2NI93|GEDH_CARLC | Geraniol dehydrogenase OS=Carpoglyphus lactis GN=gedh PE=1 SV=2 | 12 | 358 | 1.0E-14 |
| sp|Q06004|DHSO_BACSU | Sorbitol dehydrogenase OS=Bacillus subtilis (strain 168) GN=gutB PE=1 SV=3 | 7 | 295 | 1.0E-14 |
| sp|Q82MN2|TDH_STRAW | L-threonine 3-dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tdh PE=3 SV=1 | 29 | 303 | 2.0E-14 |
| sp|Q13SG2|TDH_BURXL | L-threonine 3-dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=tdh PE=3 SV=1 | 31 | 307 | 2.0E-14 |
| sp|B0TYR8|TDH_FRAP2 | L-threonine 3-dehydrogenase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=tdh PE=3 SV=1 | 43 | 307 | 2.0E-14 |
| sp|A9AR24|TDH_BURM1 | L-threonine 3-dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=tdh PE=3 SV=1 | 31 | 307 | 2.0E-14 |
| sp|P00326|ADH1G_HUMAN | Alcohol dehydrogenase 1C OS=Homo sapiens GN=ADH1C PE=1 SV=2 | 12 | 351 | 2.0E-14 |
| sp|A1D9C9|XYL2_NEOFI | Probable D-xylulose reductase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xdhA PE=3 SV=1 | 36 | 351 | 3.0E-14 |
| sp|B4EFZ7|TDH_BURCJ | L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=tdh PE=3 SV=1 | 31 | 307 | 3.0E-14 |
| sp|A0B459|TDH_BURCH | L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) GN=tdh PE=3 SV=1 | 31 | 307 | 3.0E-14 |
| sp|B1K269|TDH_BURCC | L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) GN=tdh PE=3 SV=1 | 31 | 307 | 3.0E-14 |
| sp|Q1BK24|TDH_BURCA | L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) GN=tdh PE=3 SV=1 | 31 | 307 | 3.0E-14 |
| sp|Q63PD9|TDH_BURPS | L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=tdh PE=3 SV=1 | 31 | 307 | 3.0E-14 |
| sp|A3NF91|TDH_BURP6 | L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain 668) GN=tdh PE=3 SV=1 | 31 | 307 | 3.0E-14 |
| sp|Q3JID4|TDH_BURP1 | L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=tdh PE=3 SV=1 | 31 | 307 | 3.0E-14 |
| sp|A3P139|TDH_BURP0 | L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain 1106a) GN=tdh PE=3 SV=1 | 31 | 307 | 3.0E-14 |
| sp|A1UXP8|TDH_BURMS | L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain SAVP1) GN=tdh PE=3 SV=1 | 31 | 307 | 3.0E-14 |
| sp|Q62EL5|TDH_BURMA | L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=tdh PE=3 SV=1 | 31 | 307 | 3.0E-14 |
| sp|A2RZW5|TDH_BURM9 | L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain NCTC 10229) GN=tdh PE=3 SV=1 | 31 | 307 | 3.0E-14 |
| sp|A3MAC8|TDH_BURM7 | L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain NCTC 10247) GN=tdh PE=3 SV=1 | 31 | 307 | 3.0E-14 |
| sp|B2T7X5|TDH_BURPP | L-threonine 3-dehydrogenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=tdh PE=3 SV=1 | 31 | 358 | 3.0E-14 |
| sp|Q38ZS8|TDH_BURL3 | L-threonine 3-dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tdh PE=3 SV=1 | 31 | 307 | 4.0E-14 |
| sp|Q0B5Q1|TDH_BURCM | L-threonine 3-dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=tdh PE=3 SV=1 | 31 | 307 | 5.0E-14 |
| sp|O58389|TDH_PYRHO | Probable L-threonine 3-dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tdh PE=1 SV=1 | 39 | 360 | 5.0E-14 |
| sp|Q6ZHS4|CADH2_ORYSJ | Cinnamyl alcohol dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CAD2 PE=1 SV=1 | 39 | 360 | 6.0E-14 |
| sp|Q0V7W6|ADHL5_ARATH | Alcohol dehydrogenase-like 5 OS=Arabidopsis thaliana GN=At4g22110 PE=2 SV=1 | 14 | 351 | 6.0E-14 |
| sp|B1YXP0|TDH_BURA4 | L-threonine 3-dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) GN=tdh PE=3 SV=1 | 31 | 307 | 7.0E-14 |
| sp|Q2T9E1|TDH_BURTA | L-threonine 3-dehydrogenase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tdh PE=3 SV=1 | 31 | 307 | 9.0E-14 |
| sp|A4JKG7|TDH_BURVG | L-threonine 3-dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tdh PE=3 SV=1 | 31 | 307 | 1.0E-13 |
| sp|Q9UYX0|TDH_PYRAB | Probable L-threonine 3-dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tdh PE=3 SV=1 | 39 | 360 | 1.0E-13 |
| sp|A5IGK7|TDH_LEGPC | L-threonine 3-dehydrogenase OS=Legionella pneumophila (strain Corby) GN=tdh PE=3 SV=1 | 43 | 307 | 1.0E-13 |
| sp|Q5WYJ7|TDH_LEGPL | L-threonine 3-dehydrogenase OS=Legionella pneumophila (strain Lens) GN=tdh PE=3 SV=1 | 43 | 307 | 1.0E-13 |
| sp|Q9RTU4|TDH_DEIRA | L-threonine 3-dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tdh PE=3 SV=2 | 20 | 303 | 1.0E-13 |
| sp|Q5ZXM9|TDH_LEGPH | L-threonine 3-dehydrogenase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tdh PE=3 SV=2 | 43 | 307 | 1.0E-13 |
| sp|O82056|CADH_SACOF | Probable cinnamyl alcohol dehydrogenase OS=Saccharum officinarum GN=CAD PE=2 SV=1 | 39 | 360 | 1.0E-13 |
| sp|B4UMJ1|TDH_ANASK | L-threonine 3-dehydrogenase OS=Anaeromyxobacter sp. (strain K) GN=tdh PE=3 SV=1 | 41 | 358 | 1.0E-13 |
| sp|B2JPU0|TDH_BURP8 | L-threonine 3-dehydrogenase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=tdh PE=3 SV=1 | 31 | 307 | 2.0E-13 |
| sp|Q5XI95|ADH6_RAT | Alcohol dehydrogenase 6 OS=Rattus norvegicus GN=Adh6 PE=2 SV=1 | 12 | 244 | 2.0E-13 |
| sp|Q5X748|TDH_LEGPA | L-threonine 3-dehydrogenase OS=Legionella pneumophila (strain Paris) GN=tdh PE=3 SV=1 | 43 | 307 | 3.0E-13 |
| sp|P80512|ADH1_NAJNA | Alcohol dehydrogenase 1 OS=Naja naja PE=1 SV=1 | 12 | 351 | 3.0E-13 |
| sp|Q8U259|TDH_PYRFU | Probable L-threonine 3-dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tdh PE=3 SV=1 | 10 | 360 | 3.0E-13 |
| sp|P86883|ADH1_COLLI | Alcohol dehydrogenase 1 OS=Columba livia GN=ADH1 PE=1 SV=1 | 12 | 358 | 4.0E-13 |
| sp|C1D195|TDH_DEIDV | L-threonine 3-dehydrogenase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=tdh PE=3 SV=1 | 18 | 358 | 4.0E-13 |
| sp|P80338|ADH1_STRCA | Alcohol dehydrogenase 1 OS=Struthio camelus GN=ADH1 PE=1 SV=1 | 12 | 358 | 4.0E-13 |
| sp|B8J714|TDH_ANAD2 | L-threonine 3-dehydrogenase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=tdh PE=3 SV=1 | 41 | 358 | 5.0E-13 |
| sp|O97959|ADH1G_PAPHA | Alcohol dehydrogenase 1C OS=Papio hamadryas GN=ADH1C PE=2 SV=3 | 12 | 358 | 7.0E-13 |
| sp|P25405|ADH1A_SAAHA | Alcohol dehydrogenase 1A OS=Saara hardwickii PE=1 SV=2 | 12 | 358 | 7.0E-13 |
| sp|Q65JE7|TDH_BACLD | L-threonine 3-dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tdh PE=3 SV=1 | 41 | 307 | 7.0E-13 |
| sp|Q5GWI3|TDH_XANOR | L-threonine 3-dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tdh PE=3 SV=2 | 30 | 358 | 8.0E-13 |
| sp|Q2NZP2|TDH_XANOM | L-threonine 3-dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tdh PE=3 SV=1 | 30 | 358 | 8.0E-13 |
| sp|P23991|ADH1_CHICK | Alcohol dehydrogenase 1 OS=Gallus gallus GN=ADH1 PE=1 SV=2 | 12 | 252 | 8.0E-13 |
| sp|O35017|YOGA_BACSU | Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 | 27 | 356 | 9.0E-13 |
| sp|Q1RFI7|FRMA_ECOUT | S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=frmA PE=3 SV=1 | 38 | 351 | 9.0E-13 |
| sp|Q0TKS7|FRMA_ECOL5 | S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=frmA PE=3 SV=1 | 38 | 351 | 9.0E-13 |
| sp|A1A835|FRMA_ECOK1 | S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=frmA PE=3 SV=1 | 38 | 351 | 9.0E-13 |
| sp|P14139|ADH1B_PAPHA | Alcohol dehydrogenase 1B OS=Papio hamadryas GN=ADH1B PE=2 SV=2 | 12 | 351 | 1.0E-12 |
| sp|P86885|ADH1_MESAU | Alcohol dehydrogenase 1 OS=Mesocricetus auratus GN=ADH1 PE=1 SV=1 | 12 | 251 | 1.0E-12 |
| sp|P25437|FRMA_ECOLI | S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain K12) GN=frmA PE=1 SV=3 | 38 | 351 | 1.0E-12 |
| sp|Q9L233|TDH_STRCO | L-threonine 3-dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tdh PE=3 SV=1 | 40 | 303 | 1.0E-12 |
| sp|Q72L62|TDH_THET2 | L-threonine 3-dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tdh PE=3 SV=1 | 30 | 314 | 1.0E-12 |
| sp|Q5UQG2|YL498_MIMIV | Probable zinc-type alcohol dehydrogenase-like protein L498 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L498 PE=1 SV=1 | 8 | 360 | 2.0E-12 |
| sp|P00325|ADH1B_HUMAN | Alcohol dehydrogenase 1B OS=Homo sapiens GN=ADH1B PE=1 SV=2 | 12 | 351 | 2.0E-12 |
| sp|Q2IJN4|TDH_ANADE | L-threonine 3-dehydrogenase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tdh PE=3 SV=1 | 41 | 358 | 2.0E-12 |
| sp|B2FQN4|TDH_STRMK | L-threonine 3-dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=tdh PE=3 SV=1 | 27 | 358 | 2.0E-12 |
| sp|P86884|ADHX_SCYCA | Alcohol dehydrogenase class-3 OS=Scyliorhinus canicula PE=1 SV=1 | 12 | 351 | 2.0E-12 |
| sp|P19631|ADH1_COTJA | Alcohol dehydrogenase 1 OS=Coturnix coturnix japonica GN=ADH1 PE=1 SV=1 | 12 | 351 | 2.0E-12 |
| sp|Q3Z550|FRMA_SHISS | S-(hydroxymethyl)glutathione dehydrogenase OS=Shigella sonnei (strain Ss046) GN=frmA PE=3 SV=1 | 38 | 351 | 2.0E-12 |
| sp|B1J085|FRMA_ECOLC | S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=frmA PE=3 SV=1 | 38 | 351 | 2.0E-12 |
| sp|A7ZX04|FRMA_ECOHS | S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=frmA PE=3 SV=1 | 38 | 351 | 2.0E-12 |
| sp|Q8X5J4|FRMA_ECO57 | S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O157:H7 GN=frmA PE=3 SV=1 | 38 | 351 | 2.0E-12 |
| sp|A7ZIA4|FRMA_ECO24 | S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=frmA PE=3 SV=1 | 38 | 351 | 2.0E-12 |
| sp|Q8FKG1|FRMA_ECOL6 | S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=frmA PE=3 SV=1 | 38 | 351 | 2.0E-12 |
| sp|Q5R1W2|ADH1B_PANTR | Alcohol dehydrogenase 1B OS=Pan troglodytes GN=ADH1B PE=2 SV=3 | 12 | 351 | 3.0E-12 |
| sp|O34268|TDH_XANCP | L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tdh PE=3 SV=1 | 30 | 358 | 3.0E-12 |
| sp|B0RU31|TDH_XANCB | L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=tdh PE=3 SV=1 | 30 | 358 | 3.0E-12 |
| sp|Q4URI9|TDH_XANC8 | L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tdh PE=3 SV=1 | 30 | 358 | 3.0E-12 |
| sp|Q5SKS4|TDH_THET8 | L-threonine 3-dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tdh PE=1 SV=1 | 30 | 314 | 4.0E-12 |
| sp|P14219|ADH1_PENAM | Alcohol dehydrogenase 1 OS=Pennisetum americanum GN=ADH1 PE=2 SV=1 | 12 | 351 | 5.0E-12 |
| sp|Q83F39|TDH_COXBU | L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tdh PE=3 SV=1 | 38 | 359 | 5.0E-12 |
| sp|A9NA21|TDH_COXBR | L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tdh PE=3 SV=1 | 38 | 359 | 5.0E-12 |
| sp|A9KET6|TDH_COXBN | L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tdh PE=3 SV=1 | 38 | 359 | 5.0E-12 |
| sp|B6J2S1|TDH_COXB2 | L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain CbuG_Q212) GN=tdh PE=3 SV=1 | 38 | 359 | 5.0E-12 |
| sp|P07327|ADH1A_HUMAN | Alcohol dehydrogenase 1A OS=Homo sapiens GN=ADH1A PE=1 SV=2 | 12 | 358 | 5.0E-12 |
| sp|A7HEI5|TDH_ANADF | L-threonine 3-dehydrogenase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=tdh PE=3 SV=1 | 44 | 307 | 5.0E-12 |
| sp|P00328|ADH1S_HORSE | Alcohol dehydrogenase S chain OS=Equus caballus PE=1 SV=3 | 12 | 251 | 6.0E-12 |
| sp|Q2R8Z5|ADH1_ORYSJ | Alcohol dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=ADH1 PE=2 SV=2 | 12 | 351 | 6.0E-12 |
| sp|Q75ZX4|ADH1_ORYSI | Alcohol dehydrogenase 1 OS=Oryza sativa subsp. indica GN=ADH1 PE=2 SV=1 | 12 | 351 | 6.0E-12 |
| sp|Q1MDT5|TDH_RHIL3 | L-threonine 3-dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=tdh PE=3 SV=1 | 36 | 307 | 6.0E-12 |
| sp|Q0ITW7|ADH2_ORYSJ | Alcohol dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=ADH2 PE=2 SV=2 | 12 | 360 | 7.0E-12 |
| sp|Q4R1E8|ADH2_ORYSI | Alcohol dehydrogenase 2 OS=Oryza sativa subsp. indica GN=ADH2 PE=2 SV=1 | 12 | 360 | 7.0E-12 |
| sp|P28469|ADH1A_MACMU | Alcohol dehydrogenase 1A OS=Macaca mulatta GN=ADH1A PE=2 SV=2 | 12 | 351 | 8.0E-12 |
| sp|Q3BWT0|TDH_XANC5 | L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tdh PE=3 SV=1 | 30 | 358 | 8.0E-12 |
| sp|Q03505|ADH1_RABIT | Alcohol dehydrogenase 1 OS=Oryctolagus cuniculus GN=ADH1 PE=1 SV=2 | 12 | 351 | 9.0E-12 |
| sp|Q2MFP3|DOIAD_STRRY | 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces rimosus subsp. paromomycinus GN=parE PE=3 SV=1 | 36 | 301 | 1.0E-11 |
| sp|A4FND4|TDH_SACEN | L-threonine 3-dehydrogenase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tdh PE=3 SV=1 | 43 | 307 | 1.0E-11 |
| sp|O24562|CADH_MAIZE | Probable cinnamyl alcohol dehydrogenase OS=Zea mays GN=CAD PE=2 SV=1 | 39 | 360 | 1.0E-11 |
| sp|Q2K618|TDH_RHIEC | L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tdh PE=3 SV=1 | 36 | 307 | 1.0E-11 |
| sp|B3PUI4|TDH_RHIE6 | L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=tdh PE=3 SV=1 | 36 | 307 | 1.0E-11 |
| sp|P46415|ADHX_DROME | Alcohol dehydrogenase class-3 OS=Drosophila melanogaster GN=Fdh PE=1 SV=3 | 10 | 299 | 1.0E-11 |
| sp|P00327|ADH1E_HORSE | Alcohol dehydrogenase E chain OS=Equus caballus PE=1 SV=2 | 12 | 251 | 1.0E-11 |
| sp|Q5RBP7|ADH1A_PONAB | Alcohol dehydrogenase 1A OS=Pongo abelii GN=ADH1A PE=2 SV=3 | 12 | 358 | 2.0E-11 |
| sp|B1LIP1|FRMA_ECOSM | S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=frmA PE=3 SV=1 | 38 | 351 | 2.0E-11 |
| sp|Q11L77|TDH_CHESB | L-threonine 3-dehydrogenase OS=Chelativorans sp. (strain BNC1) GN=tdh PE=3 SV=1 | 36 | 238 | 2.0E-11 |
| sp|P06757|ADH1_RAT | Alcohol dehydrogenase 1 OS=Rattus norvegicus GN=Adh1 PE=1 SV=3 | 12 | 351 | 2.0E-11 |
| sp|P04707|ADH2_MAIZE | Alcohol dehydrogenase 2 OS=Zea mays GN=ADH2 PE=2 SV=1 | 12 | 360 | 2.0E-11 |
| sp|P0DMQ6|DHSO_CHICK | Sorbitol dehydrogenase OS=Gallus gallus GN=SORD PE=1 SV=1 | 11 | 309 | 2.0E-11 |
| sp|P00329|ADH1_MOUSE | Alcohol dehydrogenase 1 OS=Mus musculus GN=Adh1 PE=1 SV=2 | 12 | 251 | 2.0E-11 |
| sp|P05336|ADH1_HORVU | Alcohol dehydrogenase 1 OS=Hordeum vulgare GN=ADH1 PE=2 SV=1 | 12 | 351 | 3.0E-11 |
| sp|P93243|AHNL_LINUS | Aliphatic (R)-hydroxynitrile lyase OS=Linum usitatissimum PE=1 SV=1 | 44 | 233 | 3.0E-11 |
| sp|O74540|FADH2_SCHPO | Putative S-(hydroxymethyl)glutathione dehydrogenase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC13B11.04c PE=3 SV=2 | 12 | 351 | 3.0E-11 |
| sp|Q54TC2|ADHX_DICDI | Alcohol dehydrogenase class-3 OS=Dictyostelium discoideum GN=adh5 PE=3 SV=1 | 10 | 351 | 3.0E-11 |
| sp|P77280|YDJJ_ECOLI | Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjJ OS=Escherichia coli (strain K12) GN=ydjJ PE=3 SV=1 | 25 | 287 | 3.0E-11 |
| sp|Q2MF22|DOIAD_STRSD | 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptoalloteichus tenebrarius (strain ATCC 17920 / DSM 40477 / NCIB 11028) GN=tobE PE=3 SV=1 | 14 | 329 | 4.0E-11 |
| sp|Q70KF0|DOIAD_MICEC | 2-deoxy-scyllo-inosamine dehydrogenase OS=Micromonospora echinospora GN=gacH PE=3 SV=1 | 36 | 329 | 4.0E-11 |
| sp|P93629|ADHX_MAIZE | Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH PE=2 SV=1 | 10 | 350 | 4.0E-11 |
| sp|Q8PNN2|TDH_XANAC | L-threonine 3-dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tdh PE=3 SV=1 | 30 | 358 | 4.0E-11 |
| sp|P44557|FRMA_HAEIN | S-(hydroxymethyl)glutathione dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=frmA PE=3 SV=1 | 12 | 351 | 5.0E-11 |
| sp|Q64437|ADH7_MOUSE | Alcohol dehydrogenase class 4 mu/sigma chain OS=Mus musculus GN=Adh7 PE=2 SV=2 | 12 | 244 | 5.0E-11 |
| sp|P14940|ADH_CUPNE | Alcohol dehydrogenase OS=Cupriavidus necator GN=adh PE=3 SV=1 | 36 | 328 | 5.0E-11 |
| sp|P00333|ADH1_MAIZE | Alcohol dehydrogenase 1 OS=Zea mays GN=ADH1 PE=2 SV=1 | 12 | 351 | 5.0E-11 |
| sp|P12886|ADH1_PEA | Alcohol dehydrogenase 1 OS=Pisum sativum PE=3 SV=1 | 12 | 360 | 5.0E-11 |
| sp|Q983J7|TDH_RHILO | L-threonine 3-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=tdh PE=3 SV=1 | 36 | 238 | 6.0E-11 |
| sp|P49645|ADH1_APTAU | Alcohol dehydrogenase 1 OS=Apteryx australis GN=ADH1 PE=1 SV=2 | 12 | 252 | 6.0E-11 |
| sp|Q0KDL6|ADH_CUPNH | Alcohol dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=adh PE=1 SV=1 | 36 | 328 | 6.0E-11 |
| sp|P0CL53|FADH_ASPOR | S-(hydroxymethyl)glutathione dehydrogenase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=FDH1 PE=3 SV=1 | 33 | 350 | 6.0E-11 |
| sp|O07737|Y1895_MYCTU | Probable zinc-binding alcohol dehydrogenase Rv1895 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1895 PE=1 SV=1 | 14 | 329 | 7.0E-11 |
| sp|A7Z4X0|TDH_BACMF | L-threonine 3-dehydrogenase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tdh PE=3 SV=1 | 27 | 358 | 9.0E-11 |
| sp|P06525|ADH1_ARATH | Alcohol dehydrogenase class-P OS=Arabidopsis thaliana GN=ADH1 PE=1 SV=2 | 12 | 286 | 9.0E-11 |
| sp|P39400|LGOD_ECOLI | L-galactonate-5-dehydrogenase OS=Escherichia coli (strain K12) GN=lgoD PE=1 SV=3 | 26 | 359 | 1.0E-10 |
| sp|Q06099|FADH_CANMA | S-(hydroxymethyl)glutathione dehydrogenase OS=Candida maltosa GN=FDH1 PE=3 SV=1 | 8 | 350 | 1.0E-10 |
| sp|P41682|ADH7_RAT | Alcohol dehydrogenase class 4 mu/sigma chain OS=Rattus norvegicus GN=Adh7 PE=1 SV=2 | 12 | 244 | 1.0E-10 |
| sp|Q5R7Z8|ADH6_PONAB | Alcohol dehydrogenase 6 OS=Pongo abelii GN=ADH6 PE=2 SV=1 | 12 | 358 | 1.0E-10 |
| sp|P35497|DHSO1_YEAST | Sorbitol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOR1 PE=3 SV=1 | 7 | 329 | 2.0E-10 |
| sp|P33010|TERPD_PSESP | Probable alcohol dehydrogenase OS=Pseudomonas sp. GN=terPD PE=3 SV=1 | 41 | 311 | 2.0E-10 |
| sp|P39450|FRMA_PHODP | S-(hydroxymethyl)glutathione dehydrogenase OS=Photobacterium damsela subsp. piscicida GN=frmA PE=3 SV=1 | 38 | 351 | 2.0E-10 |
| sp|B1VWE7|TDH_STRGG | L-threonine 3-dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=tdh PE=3 SV=1 | 29 | 307 | 2.0E-10 |
| sp|P17648|ADH_FRAAN | Alcohol dehydrogenase OS=Fragaria ananassa GN=ADH PE=3 SV=2 | 12 | 320 | 3.0E-10 |
| sp|P13603|ADH1_TRIRP | Alcohol dehydrogenase 1 OS=Trifolium repens GN=ADH1 PE=2 SV=1 | 12 | 360 | 3.0E-10 |
| sp|Q53U21|DOIAD_STRFR | 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces fradiae GN=neoA PE=1 SV=1 | 39 | 329 | 4.0E-10 |
| sp|Q96533|ADHX_ARATH | Alcohol dehydrogenase class-3 OS=Arabidopsis thaliana GN=ADH2 PE=1 SV=2 | 10 | 350 | 4.0E-10 |
| sp|Q4R0J7|ARD1_UROFA | D-arabinitol dehydrogenase 1 OS=Uromyces fabae GN=ARD1 PE=1 SV=1 | 11 | 309 | 4.0E-10 |
| sp|P22797|ADH1_PELPE | Alcohol dehydrogenase 1 OS=Pelophylax perezi PE=1 SV=1 | 12 | 351 | 5.0E-10 |
| sp|P81601|ADHL_GADMO | Alcohol dehydrogenase class-3 chain L OS=Gadus morhua PE=1 SV=1 | 12 | 351 | 5.0E-10 |
| sp|Q6MD15|TDH_PARUW | L-threonine 3-dehydrogenase OS=Protochlamydia amoebophila (strain UWE25) GN=tdh PE=3 SV=1 | 34 | 307 | 5.0E-10 |
| sp|Q4R0W1|DOIAD_STRRI | 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces ribosidificus GN=rbmC PE=3 SV=1 | 39 | 328 | 5.0E-10 |
| sp|Q5JI69|TDH_THEKO | Probable L-threonine 3-dehydrogenase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tdh PE=1 SV=1 | 39 | 358 | 6.0E-10 |
| sp|Q07993|XYL2_YEAST | D-xylulose reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XYL2 PE=1 SV=1 | 10 | 328 | 7.0E-10 |
| sp|P10848|ADH3_HORVU | Alcohol dehydrogenase 3 OS=Hordeum vulgare GN=ADH3 PE=3 SV=1 | 12 | 351 | 8.0E-10 |
| sp|O42909|YBI2_SCHPO | Zinc-type alcohol dehydrogenase-like protein C16A3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.02c PE=3 SV=1 | 1 | 359 | 8.0E-10 |
| sp|P08319|ADH4_HUMAN | Alcohol dehydrogenase 4 OS=Homo sapiens GN=ADH4 PE=1 SV=5 | 12 | 329 | 9.0E-10 |
| sp|O46649|ADHP_RABIT | Alcohol dehydrogenase class-2 isozyme 1 OS=Oryctolagus cuniculus GN=ADH2-1 PE=2 SV=2 | 1 | 307 | 1.0E-09 |
| sp|P48977|ADH_MALDO | Alcohol dehydrogenase OS=Malus domestica GN=ADH PE=2 SV=1 | 12 | 316 | 1.0E-09 |
| sp|A2XAZ3|ADHX_ORYSI | Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. indica GN=ADHIII PE=3 SV=1 | 10 | 350 | 1.0E-09 |
| sp|B5ZXE7|TDH_RHILW | L-threonine 3-dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=tdh PE=3 SV=1 | 36 | 307 | 1.0E-09 |
| sp|Q3ZC42|ADHX_BOVIN | Alcohol dehydrogenase class-3 OS=Bos taurus GN=ADH5 PE=2 SV=1 | 12 | 360 | 1.0E-09 |
| sp|Q0DWH1|ADHX_ORYSJ | Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. japonica GN=Os02g0815500 PE=2 SV=1 | 10 | 350 | 2.0E-09 |
| sp|P25406|ADH1B_SAAHA | Alcohol dehydrogenase 1B OS=Saara hardwickii PE=1 SV=2 | 12 | 351 | 2.0E-09 |
| sp|P38230|QOR_YEAST | Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 | 7 | 360 | 2.0E-09 |
| sp|P77360|YPHC_ECOLI | Uncharacterized zinc-type alcohol dehydrogenase-like protein YphC OS=Escherichia coli (strain K12) GN=yphC PE=3 SV=2 | 41 | 227 | 2.0E-09 |
| sp|O35045|YJMD_BACSU | Uncharacterized zinc-type alcohol dehydrogenase-like protein YjmD OS=Bacillus subtilis (strain 168) GN=yjmD PE=2 SV=1 | 31 | 323 | 2.0E-09 |
| sp|P43903|QOR_PSEAE | Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 | 28 | 358 | 2.0E-09 |
| sp|Q64415|ADH1_GEOKN | Alcohol dehydrogenase 1 OS=Geomys knoxjonesi GN=ADH1 PE=2 SV=3 | 12 | 351 | 2.0E-09 |
| sp|Q67N85|TDH_SYMTH | L-threonine 3-dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tdh PE=3 SV=1 | 39 | 314 | 2.0E-09 |
| sp|C5J3R8|LAD_TALEM | L-arabinitol 4-dehydrogenase OS=Talaromyces emersonii GN=lad PE=1 SV=1 | 36 | 223 | 3.0E-09 |
| sp|Q9Z2M2|ADH1_GEOAT | Alcohol dehydrogenase 1 OS=Geomys attwateri GN=ADH1 PE=2 SV=3 | 12 | 351 | 3.0E-09 |
| sp|Q7SI09|LAD_NEUCR | L-arabinitol 4-dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ard-1 PE=1 SV=1 | 31 | 284 | 3.0E-09 |
| sp|Q64413|ADH1_GEOBU | Alcohol dehydrogenase 1 OS=Geomys bursarius GN=ADH1 PE=2 SV=3 | 12 | 351 | 3.0E-09 |
| sp|P80467|ADHX_SAAHA | Alcohol dehydrogenase class-3 OS=Saara hardwickii PE=1 SV=1 | 12 | 360 | 3.0E-09 |
| sp|P79896|ADHX_SPAAU | Alcohol dehydrogenase class-3 OS=Sparus aurata PE=2 SV=1 | 12 | 351 | 4.0E-09 |
| sp|P28332|ADH6_HUMAN | Alcohol dehydrogenase 6 OS=Homo sapiens GN=ADH6 PE=1 SV=2 | 12 | 351 | 4.0E-09 |
| sp|Q02BT1|TDH_SOLUE | L-threonine 3-dehydrogenase OS=Solibacter usitatus (strain Ellin6076) GN=tdh PE=3 SV=1 | 41 | 307 | 5.0E-09 |
| sp|P28032|ADH2_SOLLC | Alcohol dehydrogenase 2 OS=Solanum lycopersicum GN=ADH2 PE=2 SV=2 | 12 | 251 | 5.0E-09 |
| sp|O19053|ADHX_RABIT | Alcohol dehydrogenase class-3 OS=Oryctolagus cuniculus GN=ADH5 PE=2 SV=3 | 12 | 244 | 5.0E-09 |
| sp|Q6AYT0|QOR_RAT | Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 | 9 | 252 | 6.0E-09 |
| sp|Q9FH04|ADHL7_ARATH | Alcohol dehydrogenase-like 7 OS=Arabidopsis thaliana GN=At5g42250 PE=2 SV=1 | 14 | 250 | 7.0E-09 |
| sp|P12711|ADHX_RAT | Alcohol dehydrogenase class-3 OS=Rattus norvegicus GN=Adh5 PE=1 SV=2 | 12 | 251 | 8.0E-09 |
| sp|Q8VZ49|ADHL4_ARATH | Alcohol dehydrogenase-like 4 OS=Arabidopsis thaliana GN=At1g64710 PE=2 SV=1 | 10 | 311 | 1.0E-08 |
| sp|Q6L743|DOIAD_STRKN | 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces kanamyceticus GN=kanE PE=3 SV=1 | 38 | 321 | 1.0E-08 |
| sp|P28474|ADHX_MOUSE | Alcohol dehydrogenase class-3 OS=Mus musculus GN=Adh5 PE=1 SV=3 | 12 | 251 | 1.0E-08 |
| sp|P25141|ADH1_PETHY | Alcohol dehydrogenase 1 OS=Petunia hybrida GN=ADH1 PE=3 SV=1 | 12 | 325 | 2.0E-08 |
| sp|P19854|ADHX_HORSE | Alcohol dehydrogenase class-3 OS=Equus caballus GN=ADH5 PE=1 SV=2 | 12 | 251 | 2.0E-08 |
| sp|P81431|ADHX_OCTVU | Alcohol dehydrogenase class-3 OS=Octopus vulgaris PE=1 SV=1 | 8 | 236 | 2.0E-08 |
| sp|P80572|ADHX_PEA | Alcohol dehydrogenase class-3 OS=Pisum sativum PE=1 SV=1 | 10 | 251 | 3.0E-08 |
| sp|O74489|QOR_SCHPO | Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 | 25 | 306 | 3.0E-08 |
| sp|Q9FJ95|DHSO_ARATH | Sorbitol dehydrogenase OS=Arabidopsis thaliana GN=SDH PE=1 SV=1 | 30 | 309 | 3.0E-08 |
| sp|P14675|ADH3_SOLTU | Alcohol dehydrogenase 3 OS=Solanum tuberosum GN=ADH3 PE=2 SV=1 | 12 | 251 | 3.0E-08 |
| sp|P14673|ADH1_SOLTU | Alcohol dehydrogenase 1 OS=Solanum tuberosum GN=ADH1 PE=2 SV=1 | 12 | 338 | 3.0E-08 |
| sp|O97764|QOR_BOVIN | Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 | 9 | 237 | 3.0E-08 |
| sp|P14674|ADH2_SOLTU | Alcohol dehydrogenase 2 OS=Solanum tuberosum GN=ADH2 PE=2 SV=1 | 12 | 251 | 3.0E-08 |
| sp|P26325|ADH1_GADMC | Alcohol dehydrogenase 1 OS=Gadus morhua subsp. callarias PE=1 SV=1 | 12 | 251 | 4.0E-08 |
| sp|Q2MF72|DOIAD_STRLV | 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces lividus GN=livE PE=3 SV=1 | 25 | 193 | 5.0E-08 |
| sp|P09347|FDEH_PSEPU | 5-exo-hydroxycamphor dehydrogenase OS=Pseudomonas putida GN=camD PE=1 SV=2 | 12 | 237 | 5.0E-08 |
| sp|P47199|QOR_MOUSE | Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 | 30 | 238 | 6.0E-08 |
| sp|P80360|ADHX_MYXGL | Alcohol dehydrogenase class-3 OS=Myxine glutinosa PE=1 SV=1 | 12 | 251 | 6.0E-08 |
| sp|O31776|TDH_BACSU | L-threonine 3-dehydrogenase OS=Bacillus subtilis (strain 168) GN=tdh PE=3 SV=1 | 36 | 307 | 6.0E-08 |
| sp|P11766|ADHX_HUMAN | Alcohol dehydrogenase class-3 OS=Homo sapiens GN=ADH5 PE=1 SV=4 | 12 | 251 | 7.0E-08 |
| sp|Q8LEB2|ADHL6_ARATH | Alcohol dehydrogenase-like 6 OS=Arabidopsis thaliana GN=At5g24760 PE=2 SV=2 | 2 | 240 | 7.0E-08 |
| sp|Q08257|QOR_HUMAN | Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 | 9 | 236 | 8.0E-08 |
| sp|P10847|ADH2_HORVU | Alcohol dehydrogenase 2 OS=Hordeum vulgare GN=ADH2 PE=3 SV=1 | 45 | 269 | 1.0E-07 |
| sp|O57380|ADH8_PELPE | NADP-dependent alcohol dehydrogenase OS=Pelophylax perezi GN=ADH8 PE=1 SV=3 | 10 | 269 | 1.0E-07 |
| sp|Q17335|ADHX_CAEEL | Alcohol dehydrogenase class-3 OS=Caenorhabditis elegans GN=H24K24.3 PE=2 SV=1 | 12 | 351 | 1.0E-07 |
| sp|P45382|FADH_PARDE | S-(hydroxymethyl)glutathione dehydrogenase OS=Paracoccus denitrificans GN=flhA PE=1 SV=1 | 38 | 358 | 2.0E-07 |
| sp|P81600|ADHH_GADMO | Alcohol dehydrogenase class-3 chain H OS=Gadus morhua PE=1 SV=1 | 12 | 251 | 2.0E-07 |
| sp|Q24K16|ZADH2_BOVIN | Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 | 7 | 360 | 2.0E-07 |
| sp|A1L4Y2|ADHL3_ARATH | Alcohol dehydrogenase-like 3 OS=Arabidopsis thaliana GN=At1g32780 PE=2 SV=1 | 10 | 360 | 2.0E-07 |
| sp|Q5R4S7|QOR_PONAB | Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 | 9 | 236 | 2.0E-07 |
| sp|O46650|ADHQ_RABIT | Alcohol dehydrogenase class-2 isozyme 2 OS=Oryctolagus cuniculus GN=ADH2-2 PE=2 SV=2 | 1 | 251 | 3.0E-07 |
| sp|Q64563|ADH4_RAT | Alcohol dehydrogenase 4 OS=Rattus norvegicus GN=Adh4 PE=2 SV=3 | 10 | 329 | 4.0E-07 |
| sp|P38105|RSPB_ECOLI | Starvation-sensing protein RspB OS=Escherichia coli (strain K12) GN=rspB PE=2 SV=1 | 14 | 283 | 4.0E-07 |
| sp|Q92MT4|XYLD_RHIME | Putative D-xylulose reductase OS=Rhizobium meliloti (strain 1021) GN=R02526 PE=3 SV=1 | 14 | 293 | 5.0E-07 |
| sp|Q8N4Q0|ZADH2_HUMAN | Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 | 7 | 235 | 8.0E-07 |
| sp|Q58D31|DHSO_BOVIN | Sorbitol dehydrogenase OS=Bos taurus GN=SORD PE=2 SV=3 | 9 | 309 | 9.0E-07 |
| sp|Q5LN53|TDH_RUEPO | L-threonine 3-dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tdh PE=3 SV=2 | 26 | 307 | 1.0E-06 |
| sp|P07846|DHSO_SHEEP | Sorbitol dehydrogenase OS=Ovis aries GN=SORD PE=1 SV=1 | 8 | 309 | 2.0E-06 |
| sp|Q82LU9|CCRA2_STRAW | Crotonyl-CoA reductase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ccrA2 PE=1 SV=1 | 107 | 352 | 2.0E-06 |
| sp|Q59545|XYLD_MORMO | D-xylulose reductase OS=Morganella morganii PE=1 SV=1 | 14 | 293 | 2.0E-06 |
| sp|Q8BGC4|ZADH2_MOUSE | Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 | 7 | 360 | 2.0E-06 |
| sp|Q3IZ91|CCR_RHOS4 | Crotonyl-CoA reductase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ccr PE=3 SV=1 | 71 | 238 | 4.0E-06 |
| sp|B6HI95|LAD_PENRW | L-arabinitol 4-dehydrogenase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lad1 PE=1 SV=1 | 37 | 217 | 5.0E-06 |
| sp|Q96V44|LAD_HYPJE | L-arabinitol 4-dehydrogenase OS=Hypocrea jecorina GN=lad1 PE=1 SV=1 | 36 | 305 | 5.0E-06 |
| sp|P96202|PPSC_MYCTU | Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 | 136 | 360 | 8.0E-06 |
| sp|Q7TXL8|PPSC_MYCBO | Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 | 136 | 360 | 8.0E-06 |
| sp|Q9ZUC1|QORL_ARATH | Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 | 1 | 234 | 8.0E-06 |
| sp|Q9QYY9|ADH4_MOUSE | Alcohol dehydrogenase 4 OS=Mus musculus GN=Adh4 PE=1 SV=4 | 39 | 329 | 9.0E-06 |
| sp|P0A9S3|GATD_ECOLI | Galactitol-1-phosphate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=gatD PE=1 SV=1 | 44 | 236 | 9.0E-06 |
| sp|P0A9S4|GATD_ECO57 | Galactitol-1-phosphate 5-dehydrogenase OS=Escherichia coli O157:H7 GN=gatD PE=3 SV=1 | 44 | 236 | 9.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 55 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 31.58 | 17.39 | 45.78 |
| Initials | Initials knots | 23.07 | 12.25 | 33.90 |
| Pileal_Stipeal_center | Stage I stipe center | 15.91 | 8.13 | 23.70 |
| Pileal_Stipeal_shell | Stage I stipe shell | 19.51 | 10.22 | 28.81 |
| DIF_stipe_center | Stage II stipe center | 12.77 | 6.31 | 19.23 |
| DIF_stipe_shell | Stage II stipe shell | 13.06 | 6.44 | 19.68 |
| DIF_stipe_skin | Stage II stipe skin | 16.24 | 8.28 | 24.20 |
| DIF_cap_skin | Stage II cap skin | 12.26 | 6.02 | 18.49 |
| DIF_cap_tissue | Stage II cap tissue | 13.89 | 6.93 | 20.86 |
| DIF_gill_tissue | Stage II gill tissue | 14.57 | 7.29 | 21.86 |
| YFB_stipe_center | Young fruiting body stipe center | 14.67 | 7.44 | 21.89 |
| YFB_stipe_shell | Young fruiting body stipe shell | 15.53 | 7.88 | 23.19 |
| YFB_stipe_skin | Young fruiting body stipe skin | 17.19 | 8.87 | 25.51 |
| YFB_cap_skin | Young fruiting body cap skin | 14.12 | 7.10 | 21.14 |
| YFB_cap_tissue | Young fruiting body cap tissue | 10.99 | 5.34 | 16.64 |
| YFB_gill_tissue | Young fruiting body gill tissue | 11.98 | 5.84 | 18.12 |
| YFB_veil | Young fruiting body veil | 17.97 | 9.33 | 26.62 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.009446 | yes |
| Casing | YFB_stipe_center | 0.009446 | yes |
| Casing | YFB_stipe_shell | 0.015529 | yes |
| Casing | YFB_stipe_skin | 0.047163 | yes |
| Casing | YFB_cap_skin | 0.006387 | yes |
| Casing | YFB_cap_tissue | 0.001140 | yes |
| Casing | YFB_gill_tissue | 0.000613 | yes |
| Casing | YFB_veil | 0.080708 | no |
| Casing | Initials | 0.407377 | no |
| Casing | Pileal_Stipeal_center | 0.020260 | yes |
| Casing | Pileal_Stipeal_shell | 0.141946 | no |
| Casing | DIF_stipe_center | 0.002084 | yes |
| Casing | DIF_stipe_shell | 0.002951 | yes |
| Casing | DIF_stipe_skin | 0.030134 | yes |
| Casing | DIF_cap_skin | 0.001625 | yes |
| Casing | DIF_cap_tissue | 0.009123 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.991834 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.920794 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.750817 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.962462 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.534082 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.696344 | no |
| DIF_gill_tissue | YFB_veil | 0.666886 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.926881 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.758030 | no |
| YFB_stipe_center | YFB_cap_skin | 0.954848 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.513528 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.676375 | no |
| YFB_stipe_center | YFB_veil | 0.672983 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.861229 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.873946 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.402033 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.553376 | no |
| YFB_stipe_shell | YFB_veil | 0.783955 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.692454 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.245876 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.361458 | no |
| YFB_stipe_skin | YFB_veil | 0.947239 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.605069 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.757680 | no |
| YFB_cap_skin | YFB_veil | 0.605124 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.892377 | no |
| YFB_cap_tissue | YFB_veil | 0.192529 | no |
| YFB_gill_tissue | YFB_veil | 0.285140 | no |
| Initials | DIF_gill_tissue | 0.197467 | no |
| Initials | YFB_stipe_center | 0.196161 | no |
| Initials | YFB_stipe_shell | 0.280761 | no |
| Initials | YFB_stipe_skin | 0.475697 | no |
| Initials | YFB_cap_skin | 0.159322 | no |
| Initials | YFB_cap_tissue | 0.022369 | yes |
| Initials | YFB_gill_tissue | 0.038720 | yes |
| Initials | YFB_veil | 0.572924 | no |
| Initials | Pileal_Stipeal_center | 0.324047 | no |
| Initials | Pileal_Stipeal_shell | 0.734377 | no |
| Initials | DIF_stipe_center | 0.072330 | no |
| Initials | DIF_stipe_shell | 0.090829 | no |
| Initials | DIF_stipe_skin | 0.363792 | no |
| Initials | DIF_cap_skin | 0.051520 | no |
| Initials | DIF_cap_tissue | 0.146718 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.887881 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.892575 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.970071 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.898684 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.832660 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.364167 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.506820 | no |
| Pileal_Stipeal_center | YFB_veil | 0.826441 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.657453 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.637874 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.686330 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.974650 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.555161 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.808270 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.491084 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.489517 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.608971 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.813187 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.426406 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.098609 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.161040 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.888633 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.239759 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.280851 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.706693 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.186682 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.403072 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.821391 | no |
| DIF_stipe_center | YFB_stipe_center | 0.802623 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.692710 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.482625 | no |
| DIF_stipe_center | YFB_cap_skin | 0.870122 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.793908 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.921121 | no |
| DIF_stipe_center | YFB_veil | 0.402283 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.973347 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.602887 | no |
| DIF_stipe_center | DIF_cap_skin | 0.952285 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.894022 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.855644 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.840625 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.735132 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.521971 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.902469 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.748495 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.888180 | no |
| DIF_stipe_shell | YFB_veil | 0.440936 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.646259 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.923552 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.925883 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.853681 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.859404 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.944641 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.930058 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.795629 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.326760 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.466104 | no |
| DIF_stipe_skin | YFB_veil | 0.861463 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.513528 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.771779 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.745048 | no |
| DIF_cap_skin | YFB_stipe_center | 0.721862 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.603949 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.404285 | no |
| DIF_cap_skin | YFB_cap_skin | 0.799466 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.860753 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.974068 | no |
| DIF_cap_skin | YFB_veil | 0.331182 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.830475 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.945387 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.934449 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.851345 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.662034 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.981057 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.641625 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.788129 | no |
| DIF_cap_tissue | YFB_veil | 0.577040 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|065020 MSSKFEIPKTQRAAVLYERKGEYRIEKEWPVTQPHELKPGQCLVKMEYTGVCHSDLTIKNRDSAPPNIPLIGGHE GVGVIVAIGEHTQDPIIKIGDRVGLKYIAKICETCEMCRSGKESLCISDTEKLTHGYQIGGTFQEYVLSYTNYVS KIPDGIDSAGATPLFCAGVTVYKAIKTLGGRLGQWVAISGAGGGLGHLAVQFAVAQGLRVIAIDTGEDKKELVLS LGAEKWIDFKESKDLVADVQLASGGLGPHAAVIATGNPQPFFQAALYLRPTGTIMCIGVPAGLAPLAVPIALIVL KGLNIIGTLVGSRLDIEELLAIVARGKVKCHYETRSLEDLNTVFSELEAGKITGRIILKI* |
| Coding | >AgabiH97|065020 ATGTCGTCGAAATTCGAGATTCCCAAGACTCAGAGGGCTGCAGTTCTATATGAACGGAAGGGGGAATATCGCATC GAGAAAGAGTGGCCCGTCACGCAACCCCATGAACTCAAGCCTGGTCAATGTCTGGTCAAGATGGAATATACGGGC GTGTGTCATTCGGATTTGACCATAAAGAATAGGGATTCCGCACCCCCAAATATTCCGCTTATAGGAGGGCACGAA GGCGTAGGAGTCATCGTGGCTATTGGTGAGCATACGCAGGACCCGATTATCAAGATAGGCGATAGAGTTGGGCTG AAATACATCGCTAAAATTTGCGAGACATGTGAGATGTGTCGTTCTGGCAAAGAAAGCTTATGCATCTCTGATACC GAGAAATTGACTCATGGGTACCAAATTGGTGGCACATTCCAAGAATATGTTCTATCCTACACGAACTACGTATCA AAAATACCGGATGGTATCGATAGCGCGGGAGCTACGCCTCTCTTCTGCGCAGGTGTGACCGTTTATAAGGCCATC AAAACCTTAGGCGGTCGCTTGGGACAGTGGGTTGCTATTTCTGGTGCTGGAGGTGGATTAGGGCATTTAGCGGTT CAGTTTGCTGTAGCGCAGGGTCTTCGCGTCATCGCGATTGATACTGGAGAAGACAAGAAAGAACTGGTGCTTAGT CTCGGTGCCGAGAAATGGATTGATTTCAAAGAATCCAAAGATTTAGTCGCCGACGTGCAGTTAGCATCTGGGGGA CTTGGTCCTCACGCAGCTGTCATCGCCACTGGAAATCCTCAACCATTTTTCCAAGCTGCCTTGTATCTGAGACCT ACTGGAACGATTATGTGCATCGGTGTGCCAGCTGGATTAGCACCTTTGGCTGTCCCCATCGCTTTGATTGTCCTC AAGGGCCTTAATATCATCGGAACACTCGTTGGTTCTCGCCTCGACATTGAGGAATTGCTCGCGATTGTTGCCCGT GGCAAAGTCAAATGCCACTATGAGACACGTAGCTTGGAGGACCTGAATACGGTGTTTTCAGAATTAGAAGCAGGG AAAATTACTGGCAGAATCATTCTCAAGATCTGA |
| Transcript | >AgabiH97|065020 ATGTCGTCGAAATTCGAGATTCCCAAGACTCAGAGGGCTGCAGTTCTATATGAACGGAAGGGGGAATATCGCATC GAGAAAGAGTGGCCCGTCACGCAACCCCATGAACTCAAGCCTGGTCAATGTCTGGTCAAGATGGAATATACGGGC GTGTGTCATTCGGATTTGACCATAAAGAATAGGGATTCCGCACCCCCAAATATTCCGCTTATAGGAGGGCACGAA GGCGTAGGAGTCATCGTGGCTATTGGTGAGCATACGCAGGACCCGATTATCAAGATAGGCGATAGAGTTGGGCTG AAATACATCGCTAAAATTTGCGAGACATGTGAGATGTGTCGTTCTGGCAAAGAAAGCTTATGCATCTCTGATACC GAGAAATTGACTCATGGGTACCAAATTGGTGGCACATTCCAAGAATATGTTCTATCCTACACGAACTACGTATCA AAAATACCGGATGGTATCGATAGCGCGGGAGCTACGCCTCTCTTCTGCGCAGGTGTGACCGTTTATAAGGCCATC AAAACCTTAGGCGGTCGCTTGGGACAGTGGGTTGCTATTTCTGGTGCTGGAGGTGGATTAGGGCATTTAGCGGTT CAGTTTGCTGTAGCGCAGGGTCTTCGCGTCATCGCGATTGATACTGGAGAAGACAAGAAAGAACTGGTGCTTAGT CTCGGTGCCGAGAAATGGATTGATTTCAAAGAATCCAAAGATTTAGTCGCCGACGTGCAGTTAGCATCTGGGGGA CTTGGTCCTCACGCAGCTGTCATCGCCACTGGAAATCCTCAACCATTTTTCCAAGCTGCCTTGTATCTGAGACCT ACTGGAACGATTATGTGCATCGGTGTGCCAGCTGGATTAGCACCTTTGGCTGTCCCCATCGCTTTGATTGTCCTC AAGGGCCTTAATATCATCGGAACACTCGTTGGTTCTCGCCTCGACATTGAGGAATTGCTCGCGATTGTTGCCCGT GGCAAAGTCAAATGCCACTATGAGACACGTAGCTTGGAGGACCTGAATACGGTGTTTTCAGAATTAGAAGCAGGG AAAATTACTGGCAGAATCATTCTCAAGATCTGA |
| Gene | >AgabiH97|065020 ATGTCGTCGAAATTCGAGATTCCCAAGACTCAGAGGGCTGCAGTTCTATATGAACGGAAGGGGGAATATCGCATC GAGAAAGAGTGGCCCGTCACGCAACCCCATGAACTCAAGCCTGGTCAATGTCTGGTCAAGATGGAATATACGGGC GTGTGTCATTCGGATTTGACCATAAAGAATAGGGATTCCGCACCCCCAAATATTCCGCTTATAGGAGGGCACGAA GGCGTAGGAGTCATCGTGGCTATTGGTGAGCATACGCAGGACCCGATTATCAAGATAGGCGATAGAGTTGGGCTG AAATACATCGCTAAAATTTGCGAGACGTACGTATCATTTCGAACTCTAACGATTAGGAGCTGACGAAGGTGATAG ATGTGAGATGTGTCGTTCTGGCAAAGAAAGCTGTGAGTGTGCCAGCTTGGGGTCAATCTAAACGAAGACCCATGC TACATTGGCCAGTATGCATCTCTGATACCGAGAAATTGACTCATGGGTACCAAATTGGTGGCACATTCCAAGAAT ATGTTGTCAGTCGATCTCTCTGTTACCCTCCGAAATCTTTGTGCATACGTCCTTTCAACTTCAGCTATCCTACAC GAACTACGTATCAAAAATACCGGATGGTATCGATAGCGCGGGAGCTACGCCTCTCTTCTGCGCAGTAAGAGTCCC TTGCTTCTGCACTTGAATCTTGAACTAACTTATCTACCAGGGTGTGACCGTTTATAAGGCCATCAAAACCTTAGG CGGTCGCTTGGGACAGTGGGTTGCTATTTCTGGTGCTGGAGGTGGATTAGGGCATTTAGGTATCTATTCATCTCG TTTCGTAGTTAATACCTCTCTGATTTTTGTTTATAGCGGTTCAGTTTGCTGTAGCGCAGGGTCTTCGCGTCATCG CGATTGGTCAGTTTATTATCTCTATCGTTATGAGTAAATCTTACGCCATGATAGATACTGGAGAAGACAAGAAAG AACTGGTGCTTAGTCTCGGTGCCGAGAAATGGATTGATTTCAAAGAATCCAAAGATTTAGTCGCCGACGTGCAGT TAGCATCTGGGGGACTTGGTCCTCACGCAGCTGTCATCGCCACTGGAAATGTAGGCGCTCTTTGATACCGCCATT ACTCCGGCTGAGCGGAACAAATTTTAGCCTCAACCATTTTTCCAAGCTGCCTTGTATCTGAGACCTACTGGAACG ATTATGTGCATCGGTGTGCCAGCTGGATTAGCACCTTTGGCTGTCCCCATCGCTTTGATTGTCCTCAAGGTTCTT TTTTTACTTCTATAGCTATTTATTTAAAGCTCAGGTTTGCTTGCTAGGGCCTTAATATCATCGGAACACTCGTTG GGTTAGTATATCTTGCGCCATTATTGGTAAATATCTGATCGTTTTCACACAGTTCTCGCCTCGACATTGAGGAAT TGCTCGCGATTGTTGCCCGTGGCAAAGTCAAATGCCACTATGAGACACGTAGCTTGGAGGACCTGAATACGTCAG TTGACCATATCCATCTGCAAAAGCAAAGCATATCCTTATTCTTTTCGACAGGGTGTTTTCAGAATTAGAAGCAGG GAAAATTACTGGCAGAATCATTCTCAAGATCTGA |