Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|064850
Gene name
Locationscaffold_3:2967578..2969887
Strand+
Gene length (bp)2309
Transcript length (bp)1965
Coding sequence length (bp)1965
Protein length (aa) 655

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 3.0E-05 351 407
PF00481 PP2C Protein phosphatase 2C 8.1E-05 482 528

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 195 654 3.0E-27
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 250 653 5.0E-15
sp|Q5RA52|PDP1_PONAB [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Pongo abelii GN=PDP1 PE=2 SV=1 251 654 2.0E-14
sp|Q9P0J1|PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens GN=PDP1 PE=1 SV=3 251 654 3.0E-14
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 251 654 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 195 654 3.0E-27
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 250 653 5.0E-15
sp|Q5RA52|PDP1_PONAB [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Pongo abelii GN=PDP1 PE=2 SV=1 251 654 2.0E-14
sp|Q9P0J1|PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens GN=PDP1 PE=1 SV=3 251 654 3.0E-14
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 251 654 2.0E-13
sp|O88483|PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus GN=Pdp1 PE=1 SV=1 251 654 3.0E-13
sp|P35816|PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus GN=PDP1 PE=1 SV=1 251 654 3.0E-13
sp|O81760|P2C63_ARATH Probable protein phosphatase 2C 63 OS=Arabidopsis thaliana GN=At4g33920 PE=2 SV=1 375 521 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004721 phosphoprotein phosphatase activity No
GO:0042578 phosphoric ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|064850
MVLFTCYNLNARDFFGRCSCDGDHTTLSVRFLLVGKDYHLLTVGISNHKTIPTRVSSSILRGGSCYWTIERTMVI
AGLRPRCRQVSAFVRSTKRYPWMKCESHSTPRGRPHRNLTILLTLPLVAVLYGIYSRQSFIRSRAVHVDPETNLS
APSHEDEDKVEDKEEDEDEVIGEEEEPLEDFLAYSPPVYDRHFWPSPEKSTEKELSQHSHIFTANLPCGIARHDL
AVVSRSLDPACFSSSHHFQLPSHYWFIFGIYDSHNGNLVASQLSQKLPFAIVDSLVELYSKHATLHNAHVNLGNG
PEYQDYWSGQGFGRPFPPPEDFDASISRAFNDLDREIVHVAAERALEAAARYQKGVSNQKNQLSFEDAASLVSNA
HCGSSAAVAIYETDTRQLRLANTGDSRAVLGRCVVDDKGVETYELHVLAHDLAVPVGFADDPPRRSRAQGSSQLH
AFGDGPWKWSKDVRERLNDAFPFIINHDHPYAEVTAQPEIITFETQPGDFLVLGSRGLWSSLSYEEAVGLVGLWL
KRYRKVVYGDRMMEERDAVSVYDPETSTMIQSSSRTRVSQVTMSSMGTGVFERRDLPVQVIGKNDDTFMYRLWGI
PKKFVVADRNVAQHLVRNALGGANVDTTEALLLIRPPRSRNFRDDVSVQVVFFN*
Coding >AgabiH97|064850
ATGGTCTTATTCACCTGTTATAATTTGAACGCCCGGGATTTTTTTGGTAGGTGCTCGTGTGATGGAGACCACACC
ACCTTGTCTGTCCGGTTCTTATTGGTAGGAAAGGACTACCATTTACTGACGGTTGGGATATCGAATCACAAAACG
ATACCGACACGTGTATCGAGTTCGATACTACGAGGTGGGTCTTGTTATTGGACGATTGAAAGGACTATGGTGATA
GCGGGTTTGAGGCCAAGATGTCGTCAAGTATCCGCTTTTGTACGATCTACGAAACGGTATCCCTGGATGAAGTGT
GAATCTCATTCGACGCCTCGGGGTCGACCTCATCGGAATCTTACTATTCTTCTCACGCTTCCTTTGGTTGCTGTC
CTCTATGGAATTTATTCGAGGCAATCCTTCATTCGGTCTCGCGCTGTTCATGTGGATCCGGAGACAAATCTATCG
GCGCCCAGTCATGAGGATGAGGACAAGGTGGAGGACAAAGAAGAGGATGAGGACGAGGTGATAGGCGAAGAAGAG
GAACCCCTGGAAGATTTCCTTGCCTATTCCCCTCCGGTGTATGACCGTCATTTCTGGCCTTCACCCGAGAAATCG
ACCGAGAAAGAACTCAGTCAACACAGTCACATTTTTACCGCAAACCTACCGTGTGGTATAGCCCGACATGATCTT
GCGGTTGTCTCCCGTTCTCTTGACCCCGCCTGTTTCTCTTCTTCACACCATTTCCAACTTCCCTCCCACTACTGG
TTTATTTTTGGAATTTACGACTCACACAACGGAAATCTGGTAGCATCACAACTTTCACAAAAGCTCCCTTTCGCC
ATTGTAGACTCTCTTGTCGAGCTTTACTCAAAGCATGCGACACTTCATAATGCGCATGTCAACCTTGGTAATGGT
CCTGAATATCAAGATTATTGGTCTGGTCAGGGATTTGGTCGACCCTTCCCACCTCCAGAGGATTTCGACGCTTCC
ATCAGTCGAGCGTTTAATGATCTAGACAGGGAAATTGTTCATGTCGCGGCCGAGCGTGCGCTTGAAGCAGCTGCG
AGGTATCAAAAAGGTGTTTCGAACCAAAAGAACCAACTTTCTTTTGAAGATGCAGCTTCGTTGGTTTCAAACGCT
CATTGTGGATCGTCAGCTGCGGTCGCTATATACGAAACTGATACACGGCAACTACGTCTGGCGAATACAGGCGAT
TCACGCGCTGTTTTGGGGAGATGTGTTGTAGATGACAAGGGTGTTGAAACGTACGAGCTGCATGTGCTTGCACAT
GATCTCGCCGTACCGGTTGGGTTCGCTGATGATCCACCACGACGCTCTCGAGCTCAAGGGTCTTCTCAGCTACAT
GCCTTTGGTGACGGTCCCTGGAAATGGAGCAAGGATGTACGGGAAAGACTCAACGACGCTTTTCCATTTATCATC
AACCATGACCATCCTTACGCTGAAGTAACGGCGCAGCCAGAAATTATTACATTTGAAACGCAGCCTGGAGACTTT
CTGGTGTTGGGAAGTCGAGGCTTATGGTCGAGTTTATCGTATGAAGAAGCTGTCGGCCTTGTGGGACTCTGGCTG
AAGAGATACAGGAAAGTGGTCTATGGTGATCGGATGATGGAAGAAAGAGACGCTGTATCTGTGTACGATCCTGAA
ACATCAACAATGATACAATCATCCTCAAGGACGCGCGTTTCTCAAGTGACGATGTCCTCCATGGGTACAGGTGTT
TTCGAAAGAAGAGATTTACCTGTACAAGTCATCGGAAAGAACGACGATACTTTTATGTATCGGCTGTGGGGGATT
CCGAAGAAATTTGTGGTCGCTGACCGAAACGTGGCGCAGCATCTGGTCAGGAATGCGCTAGGAGGTGCAAATGTG
GATACGACAGAGGCATTGCTCCTAATTCGACCACCTAGATCCAGGAATTTTCGTGATGACGTTTCTGTTCAAGTG
GTCTTTTTTAATTAA
Transcript >AgabiH97|064850
ATGGTCTTATTCACCTGTTATAATTTGAACGCCCGGGATTTTTTTGGTAGGTGCTCGTGTGATGGAGACCACACC
ACCTTGTCTGTCCGGTTCTTATTGGTAGGAAAGGACTACCATTTACTGACGGTTGGGATATCGAATCACAAAACG
ATACCGACACGTGTATCGAGTTCGATACTACGAGGTGGGTCTTGTTATTGGACGATTGAAAGGACTATGGTGATA
GCGGGTTTGAGGCCAAGATGTCGTCAAGTATCCGCTTTTGTACGATCTACGAAACGGTATCCCTGGATGAAGTGT
GAATCTCATTCGACGCCTCGGGGTCGACCTCATCGGAATCTTACTATTCTTCTCACGCTTCCTTTGGTTGCTGTC
CTCTATGGAATTTATTCGAGGCAATCCTTCATTCGGTCTCGCGCTGTTCATGTGGATCCGGAGACAAATCTATCG
GCGCCCAGTCATGAGGATGAGGACAAGGTGGAGGACAAAGAAGAGGATGAGGACGAGGTGATAGGCGAAGAAGAG
GAACCCCTGGAAGATTTCCTTGCCTATTCCCCTCCGGTGTATGACCGTCATTTCTGGCCTTCACCCGAGAAATCG
ACCGAGAAAGAACTCAGTCAACACAGTCACATTTTTACCGCAAACCTACCGTGTGGTATAGCCCGACATGATCTT
GCGGTTGTCTCCCGTTCTCTTGACCCCGCCTGTTTCTCTTCTTCACACCATTTCCAACTTCCCTCCCACTACTGG
TTTATTTTTGGAATTTACGACTCACACAACGGAAATCTGGTAGCATCACAACTTTCACAAAAGCTCCCTTTCGCC
ATTGTAGACTCTCTTGTCGAGCTTTACTCAAAGCATGCGACACTTCATAATGCGCATGTCAACCTTGGTAATGGT
CCTGAATATCAAGATTATTGGTCTGGTCAGGGATTTGGTCGACCCTTCCCACCTCCAGAGGATTTCGACGCTTCC
ATCAGTCGAGCGTTTAATGATCTAGACAGGGAAATTGTTCATGTCGCGGCCGAGCGTGCGCTTGAAGCAGCTGCG
AGGTATCAAAAAGGTGTTTCGAACCAAAAGAACCAACTTTCTTTTGAAGATGCAGCTTCGTTGGTTTCAAACGCT
CATTGTGGATCGTCAGCTGCGGTCGCTATATACGAAACTGATACACGGCAACTACGTCTGGCGAATACAGGCGAT
TCACGCGCTGTTTTGGGGAGATGTGTTGTAGATGACAAGGGTGTTGAAACGTACGAGCTGCATGTGCTTGCACAT
GATCTCGCCGTACCGGTTGGGTTCGCTGATGATCCACCACGACGCTCTCGAGCTCAAGGGTCTTCTCAGCTACAT
GCCTTTGGTGACGGTCCCTGGAAATGGAGCAAGGATGTACGGGAAAGACTCAACGACGCTTTTCCATTTATCATC
AACCATGACCATCCTTACGCTGAAGTAACGGCGCAGCCAGAAATTATTACATTTGAAACGCAGCCTGGAGACTTT
CTGGTGTTGGGAAGTCGAGGCTTATGGTCGAGTTTATCGTATGAAGAAGCTGTCGGCCTTGTGGGACTCTGGCTG
AAGAGATACAGGAAAGTGGTCTATGGTGATCGGATGATGGAAGAAAGAGACGCTGTATCTGTGTACGATCCTGAA
ACATCAACAATGATACAATCATCCTCAAGGACGCGCGTTTCTCAAGTGACGATGTCCTCCATGGGTACAGGTGTT
TTCGAAAGAAGAGATTTACCTGTACAAGTCATCGGAAAGAACGACGATACTTTTATGTATCGGCTGTGGGGGATT
CCGAAGAAATTTGTGGTCGCTGACCGAAACGTGGCGCAGCATCTGGTCAGGAATGCGCTAGGAGGTGCAAATGTG
GATACGACAGAGGCATTGCTCCTAATTCGACCACCTAGATCCAGGAATTTTCGTGATGACGTTTCTGTTCAAGTG
GTCTTTTTTAATTAA
Gene >AgabiH97|064850
ATGGTCTTATTCACCTGTTATAATGTCAATCAGATGTTAATACACGTCTAGTTTAGCTTCAGTGGCCCTGCAGTT
GAAGTGAGTTTTAGTTTGTCTGTGTTTGTTAATGGCTTTGGGTTCTGCTAACGCCTATTAGCGCCCGGGATTTTT
TTGGTAGGTGCTCGTGTGATGGAGACCACACCACCTTGTCTGTCCGGTTCTTATTGGTAGGGTGACGTACATTCA
TGTAAATCGTACTAAACTTTGAGCTGATGTTCATTCACAGAAAGGACTACCATTTACTGACGGTTGGGATATCGA
ATCACAAAACGATACCGACACGTGTATCGAGTTCGATACTACGAGGTGGGTCTTGTTATTGGACGATTGAAAGGC
AAGCTCGGACTTTTCTTCAAGTGGGATCATATCTCAAAATGTTCTTCTTTCACCCTTTCACAGGACTATGGTGAT
AGCGGGTTTGAGGCCAAGATGTCGTCAAGTATCCGCTTTTGTACGATCTACGAAACGGTATCCCTGGATGAAGTG
TGAATCTCATTCGACGCCTCGGGGTCGACCTCATCGGAATCTTACTATTCTTCTCACGCTTCCTTTGGTTGCTGT
CCTCTATGGAATTTATTCGAGGCAATCCTTCATTCGGTCTCGCGCTGTTCATGTGGATCCGGAGACAAATCTATC
GGCGCCCAGTCATGAGGATGAGGACAAGGTGGAGGACAAAGAAGAGGATGAGGACGAGGTGATAGGCGAAGAAGA
GGAACCCCTGGAAGATTTCCTTGCCTATTCCCCTCCGGTGTATGACCGTCATTTCTGGCCTTCACCCGAGAAATC
GACCGAGAAAGAACTCAGTCAACACAGTCACATTTTTACCGCAAACCTACCGTGTGGTATAGCCCGACATGATCT
TGCGGTTGTCTCCCGGTAAGTTTAAATCACTCAAAATGCAATACAAAAAAGGCATATTGATTTTCTTTTAAATTA
GTTCTCTTGACCCCGCCTGTTTCTCTTCTTCACACCATTTCCAACTTCCCTCCCACTACTGGTTTATTTTTGGAA
TTTACGACTCACACAACGGAAATCTGGTAGCATCACAACTTTCACAAAAGCTCCCTTTCGCCATTGTAGACTCTC
TTGTCGAGCTTTACTCAAAGCATGCGACACTTCATAATGCGCATGTCAACCTTGGTAATGGTCCTGAATATCAAG
ATTATTGGTCTGGTCAGGGATTTGGTCGACCCTTCCCACCTCCAGAGGATTTCGACGCTTCCATCAGTCGAGCGT
TTAATGATCTAGACAGGGAAATTGTTCATGTCGCGGCCGAGCGTGCGCTTGAAGCAGCTGCGAGGTATCAAAAAG
GTGTTTCGAACCAAAAGAACCAACTTTCTTTTGAAGATGCAGCTTCGTTGGTTTCAAACGCTCATTGTGGATCGT
CAGCTGCGGTCGCTATATACGAAACTGATACACGGCAACTACGTCTGGCGAATACAGGCGATTCACGCGCTGTTT
TGGGGAGATGTGTTGTAGATGACAAGGGTGTTGAAACGTACGAGCTGCATGTGCTTGCACATGATCTCGCCGTAC
CGGTTGGGTTCGCTGATGATCCACCACGACGCTCTCGAGCTCAAGGGTCTTCTCAGCTACATGCCTTTGGTGACG
GTCCCTGGAAATGGAGCAAGGATGTACGGGAAAGACTCAACGACGCTTTTCCATTTATCATCAACCATGACCATC
CTTACGCTGAAGTAACGGCGCAGCCAGAAATTATTACATTTGAAACGCAGCCTGGAGACTTTCTGGTGTTGGGAA
GTCGAGGCTTATGGTCGAGTTTATCGTATGAAGAAGCTGTCGGCCTTGTGGGACTCTGGCTGAAGAGATACAGGA
AAGTGGTCTATGGTGATCGGATGATGGAAGAAAGAGACGCTGTATCTGTGTACGATCCTGAAACATCAACAATGA
TACAATCATCCTCAAGGACGCGCGTTTCTCAAGTGACGATGTCCTCCATGGGTACAGGTGTTTTCGAAAGAAGAG
ATTTACCTGTACAAGTCATCGGAAAGAACGACGATACTTTTATGTATCGGCTGTGGGGGATTCCGAAGAAATTTG
TGGTCGCTGACCGAAACGTGGCGCAGCATCTGGTCAGGAATGCGCTAGGAGGTGCAAATGTGGATACGACAGAGG
CATTGCTCCTAATTCGACCACCTAGATCCAGGAATTTTCGGTATGTAGTCCATCACATTACGATTGCAAGCAATG
GAATTCTGACAGAAATTGCTAGTGATGACGTTTCTGTTCAAGTGGTCTTTTTTAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail