Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|064800
Gene name
Locationscaffold_3:2953186..2956023
Strand+
Gene length (bp)2837
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.7E-37 40 439
PF00083 Sugar_tr Sugar (and other) transporter 1.4E-09 42 226
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.2E-06 64 408

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 50 525 3.0E-54
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 7 527 2.0E-49
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 36 495 1.0E-44
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 42 500 2.0E-41
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 71 525 3.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 50 525 3.0E-54
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 7 527 2.0E-49
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 36 495 1.0E-44
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 42 500 2.0E-41
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 71 525 3.0E-38
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 26 556 4.0E-37
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 19 458 4.0E-33
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 36 458 8.0E-33
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 48 506 2.0E-32
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 30 548 5.0E-32
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 50 525 1.0E-27
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 50 525 1.0E-27
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 29 524 2.0E-25
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 2 393 2.0E-20
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 122 539 1.0E-16
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 17 454 2.0E-15
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 45 528 9.0E-15
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 36 343 1.0E-13
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 53 207 2.0E-12
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 41 450 3.0E-11
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 45 514 9.0E-11
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 45 514 9.0E-11
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 53 201 1.0E-10
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 33 269 1.0E-10
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 40 303 1.0E-10
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 40 303 1.0E-10
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 40 303 1.0E-10
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 40 290 1.0E-10
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 34 353 1.0E-10
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 40 303 1.0E-10
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 34 353 2.0E-10
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 33 372 3.0E-10
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 30 458 3.0E-10
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 36 456 3.0E-10
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 33 372 3.0E-10
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 33 372 3.0E-10
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 33 372 3.0E-10
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 33 372 3.0E-10
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 33 372 3.0E-10
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 33 372 3.0E-10
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 33 372 3.0E-10
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 30 458 5.0E-10
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 42 528 7.0E-10
sp|P32369|BAIG_CLOSV Bile acid transporter OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiG PE=3 SV=2 42 258 2.0E-09
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 62 561 2.0E-09
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 40 197 3.0E-09
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 40 197 4.0E-09
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 27 197 5.0E-09
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 42 388 5.0E-09
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 58 356 6.0E-09
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 28 233 1.0E-08
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 40 290 2.0E-08
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 40 197 3.0E-08
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 20 340 3.0E-08
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 40 303 4.0E-08
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 40 197 4.0E-08
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 27 197 5.0E-08
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 27 197 6.0E-08
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 27 197 6.0E-08
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 27 197 6.0E-08
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 27 197 6.0E-08
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 27 197 6.0E-08
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 42 221 6.0E-08
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 27 197 7.0E-08
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 27 197 7.0E-08
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 45 348 9.0E-08
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 45 348 9.0E-08
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 42 192 1.0E-07
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 42 353 1.0E-07
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 42 353 1.0E-07
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 27 197 1.0E-07
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 27 197 1.0E-07
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 54 209 2.0E-07
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 45 343 4.0E-07
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 45 343 4.0E-07
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 40 197 5.0E-07
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 40 197 5.0E-07
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 40 197 5.0E-07
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 40 197 5.0E-07
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 40 197 5.0E-07
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 40 197 5.0E-07
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 40 197 5.0E-07
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 40 197 5.0E-07
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 40 197 6.0E-07
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 45 196 6.0E-07
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 40 197 1.0E-06
sp|P02983|TCR_STAAU Tetracycline resistance protein OS=Staphylococcus aureus GN=tet PE=3 SV=3 41 356 1.0E-06
sp|P62967|TCR_STAES Tetracycline resistance protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tet PE=3 SV=1 41 356 1.0E-06
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 51 282 1.0E-06
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 20 340 2.0E-06
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 70 216 3.0E-06
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 20 195 3.0E-06
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 42 296 3.0E-06
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 42 296 3.0E-06
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 40 197 3.0E-06
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 42 257 3.0E-06
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 35 197 4.0E-06
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 43 349 5.0E-06
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 64 189 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 71 93 22
3 100 122 22
4 126 148 22
5 161 180 19
6 190 212 22
7 229 246 17
8 261 283 22
9 304 326 22
10 336 358 22
11 365 383 18
12 393 415 22
13 501 520 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|064800
MIQHDDERQPLLSLSLKSKKDPPGPHEISNSTRIGILSGVWLASFLFSFNQTLVPTMLALISSEFRKSHQASWLG
TAYLLATCTFTPLFGSLCNVLGRKGAYKTALFLAAAGCTMCGFSTSMEMLILARFLAGMGGGGILTTSSIVVSDM
YSSRSRGLAQGVAMAFNGLGQGLGGPFGGIVTDWLGWRWAFLLQIPLFALAYVLTDYNLCYVTEGKGKSTKEVLK
RIDYGGSVALMSFVGSILFFLSERFNQNLPWGSPTVVGSIAAAIVSIITFLVIELYIAPEPIMAPYILKQRIPRL
VGASNFLVANCNLTVMYFFPLWFQTVMLSNASTAGAHLLPNSLAVSAGSLFAGWIMYTTGKYKRLNSMTGILPFI
GVVGILMINENSGIVQSWFSVIPVGFGNAIAMQTSLIALLAHLPENHVALGTGFGTLFRGVGQVGGVAISSAIFQ
SRLTRELHTRITGPNAEELITRIKQQSNLVVSLPPDVQRAVRDAHSTSIKAVFVYAACLTLVSYAVRLAIPEKEL
DSRPSIAEPPEVSLPADDESEREGSVASLETDVVVVRDEGGQKHEISAKVANILFDLDKAKKADSEFGSAKF*
Coding >AgabiH97|064800
ATGATACAACATGACGATGAACGCCAACCTCTTCTTTCACTCTCTTTGAAATCCAAGAAAGATCCTCCTGGACCT
CATGAAATTTCGAACTCGACTCGTATTGGGATTCTATCTGGTGTTTGGCTGGCGTCTTTCTTGTTTTCTTTCAAT
CAAACACTAGTACCAACAATGCTTGCATTGATTTCTTCGGAATTTAGAAAATCTCATCAAGCTAGTTGGCTGGGC
ACCGCGTATCTCCTTGCGACATGCACATTCACTCCACTGTTTGGGAGTCTGTGTAATGTACTAGGACGTAAGGGT
GCATACAAGACAGCACTCTTCTTGGCGGCCGCGGGTTGTACGATGTGCGGTTTCTCTACTTCGATGGAGATGTTG
ATCCTTGCCCGCTTTCTTGCAGGAATGGGCGGTGGAGGAATATTAACTACCTCTTCGATAGTCGTCAGTGACATG
TATAGCAGTCGGAGTCGAGGCTTAGCTCAAGGAGTGGCTATGGCATTCAACGGTCTTGGCCAAGGTCTCGGAGGT
CCTTTTGGGGGAATAGTCACAGATTGGCTAGGATGGAGATGGGCGTTTCTCCTTCAGATCCCGCTATTTGCTCTG
GCATACGTTTTGACAGACTATAACCTGTGTTACGTTACAGAAGGGAAAGGAAAGAGTACAAAAGAGGTTTTAAAA
AGAATCGACTATGGTGGTAGTGTGGCGTTGATGTCTTTTGTCGGATCAATTCTTTTTTTCCTTAGTGAACGTTTC
AACCAGAATCTGCCCTGGGGTAGCCCGACTGTGGTCGGTTCCATCGCGGCTGCCATCGTTTCGATAATCACCTTC
CTGGTTATCGAGTTGTATATCGCTCCCGAGCCAATTATGGCACCCTATATCCTAAAGCAAAGGATACCCCGTCTC
GTTGGCGCATCAAATTTCCTGGTTGCGAACTGCAACCTTACTGTTATGTACTTCTTCCCTCTCTGGTTCCAGACT
GTAATGCTGTCGAATGCATCAACCGCTGGCGCCCATCTTTTACCCAACAGCCTTGCTGTGTCTGCTGGTTCGTTG
TTTGCCGGATGGATAATGTACACAACGGGAAAGTATAAGCGATTAAACTCTATGACTGGTATCTTGCCCTTCATC
GGGGTGGTTGGTATCTTGATGATCAATGAGAACTCGGGCATCGTTCAGTCATGGTTCAGCGTTATACCTGTTGGG
TTTGGCAATGCCATTGCAATGCAAACTTCGCTCATTGCATTACTGGCCCATCTTCCAGAAAATCATGTGGCACTA
GGGACAGGATTTGGCACTCTATTCCGAGGAGTTGGCCAAGTTGGAGGAGTGGCAATATCATCAGCTATTTTCCAA
TCCAGACTCACACGCGAGCTTCACACACGGATAACAGGTCCAAATGCCGAGGAGCTTATCACAAGAATAAAACAA
CAATCTAATCTTGTAGTTTCACTCCCACCTGACGTTCAACGAGCCGTTCGAGACGCCCATTCTACGAGTATAAAG
GCTGTGTTCGTTTACGCTGCATGTTTGACACTGGTATCCTACGCCGTCCGTCTTGCTATACCCGAGAAGGAGCTT
GATTCGCGCCCAAGCATCGCTGAACCTCCAGAGGTTTCCCTCCCAGCTGATGATGAATCAGAACGAGAAGGGAGC
GTGGCATCGTTAGAAACCGATGTAGTCGTGGTGAGGGACGAGGGTGGACAGAAGCACGAAATATCAGCGAAGGTT
GCAAATATTCTATTCGACCTTGACAAGGCGAAGAAGGCAGATTCTGAATTTGGATCTGCGAAGTTCTGA
Transcript >AgabiH97|064800
ATGATACAACATGACGATGAACGCCAACCTCTTCTTTCACTCTCTTTGAAATCCAAGAAAGATCCTCCTGGACCT
CATGAAATTTCGAACTCGACTCGTATTGGGATTCTATCTGGTGTTTGGCTGGCGTCTTTCTTGTTTTCTTTCAAT
CAAACACTAGTACCAACAATGCTTGCATTGATTTCTTCGGAATTTAGAAAATCTCATCAAGCTAGTTGGCTGGGC
ACCGCGTATCTCCTTGCGACATGCACATTCACTCCACTGTTTGGGAGTCTGTGTAATGTACTAGGACGTAAGGGT
GCATACAAGACAGCACTCTTCTTGGCGGCCGCGGGTTGTACGATGTGCGGTTTCTCTACTTCGATGGAGATGTTG
ATCCTTGCCCGCTTTCTTGCAGGAATGGGCGGTGGAGGAATATTAACTACCTCTTCGATAGTCGTCAGTGACATG
TATAGCAGTCGGAGTCGAGGCTTAGCTCAAGGAGTGGCTATGGCATTCAACGGTCTTGGCCAAGGTCTCGGAGGT
CCTTTTGGGGGAATAGTCACAGATTGGCTAGGATGGAGATGGGCGTTTCTCCTTCAGATCCCGCTATTTGCTCTG
GCATACGTTTTGACAGACTATAACCTGTGTTACGTTACAGAAGGGAAAGGAAAGAGTACAAAAGAGGTTTTAAAA
AGAATCGACTATGGTGGTAGTGTGGCGTTGATGTCTTTTGTCGGATCAATTCTTTTTTTCCTTAGTGAACGTTTC
AACCAGAATCTGCCCTGGGGTAGCCCGACTGTGGTCGGTTCCATCGCGGCTGCCATCGTTTCGATAATCACCTTC
CTGGTTATCGAGTTGTATATCGCTCCCGAGCCAATTATGGCACCCTATATCCTAAAGCAAAGGATACCCCGTCTC
GTTGGCGCATCAAATTTCCTGGTTGCGAACTGCAACCTTACTGTTATGTACTTCTTCCCTCTCTGGTTCCAGACT
GTAATGCTGTCGAATGCATCAACCGCTGGCGCCCATCTTTTACCCAACAGCCTTGCTGTGTCTGCTGGTTCGTTG
TTTGCCGGATGGATAATGTACACAACGGGAAAGTATAAGCGATTAAACTCTATGACTGGTATCTTGCCCTTCATC
GGGGTGGTTGGTATCTTGATGATCAATGAGAACTCGGGCATCGTTCAGTCATGGTTCAGCGTTATACCTGTTGGG
TTTGGCAATGCCATTGCAATGCAAACTTCGCTCATTGCATTACTGGCCCATCTTCCAGAAAATCATGTGGCACTA
GGGACAGGATTTGGCACTCTATTCCGAGGAGTTGGCCAAGTTGGAGGAGTGGCAATATCATCAGCTATTTTCCAA
TCCAGACTCACACGCGAGCTTCACACACGGATAACAGGTCCAAATGCCGAGGAGCTTATCACAAGAATAAAACAA
CAATCTAATCTTGTAGTTTCACTCCCACCTGACGTTCAACGAGCCGTTCGAGACGCCCATTCTACGAGTATAAAG
GCTGTGTTCGTTTACGCTGCATGTTTGACACTGGTATCCTACGCCGTCCGTCTTGCTATACCCGAGAAGGAGCTT
GATTCGCGCCCAAGCATCGCTGAACCTCCAGAGGTTTCCCTCCCAGCTGATGATGAATCAGAACGAGAAGGGAGC
GTGGCATCGTTAGAAACCGATGTAGTCGTGGTGAGGGACGAGGGTGGACAGAAGCACGAAATATCAGCGAAGGTT
GCAAATATTCTATTCGACCTTGACAAGGCGAAGAAGGCAGATTCTGAATTTGGATCTGCGAAGTTCTGA
Gene >AgabiH97|064800
ATGATACAACATGACGATGAACGCCAACCTCTTCTTTCACTCTCTTTGAAATCCAAGAAAGATCCTCCTGGACCT
CATGAAATTTCGAACTCGACTCGTATTGGGATTCTATCTGGTGTTTGGCTGGCGTCTTTCTTGTTTGTGAGTTCG
GATTTTAGCACTGCAGCTTGAATATCCACATCAACTAAACTTTTATCATATAGTCTTTCAATCGTAAGTAGTATA
GCTTCTACTACTACCATCTCCTCTAATCCACGTTTATGTGCCCTTAGAAACACTAGTACCAACAAGTATGCTTCC
TGCCTCTCCTACCATTATTTTCAATCTAATAATCCCATTTCAGTGCTTGCATTGATTTCTTCGGAATTTAGAAAA
TCTCATCAAGCTAGTTGGCTGGGCACCGCGTAAGCGAAGTCCGAACAAGCGATGCGCTAAAACCTTATTTTGATC
CATCAGGTATCTCCTTGCGACATGCACATTCACTCCACTGTTTGGGAGTCTGTGTAATGTACTAGGACGTAAGGG
TGCATACAAGACAGCACTCTTCTTGGCGGCCGCGGGTTGTACGATGTGCGGTTTCTCTACTTCGATGGAGATGTT
GATCCTTGCCCGCTTTGTAAGTTAGATATTATTATTACGGGTTTCCTGCGAGAAGTTCTTACGGGTTCTCAGCTT
GCAGGAATGGGCGGTGGAGGAATATTAACTACCTCTTCGTAAGTTCGTCATGCTTGTTGCGTCGTTTGATGATCA
ACTTCAGGATAGGATAGTCGTCAGTGACATGTATAGCAGTCGGGTAAGTCGTTGCTCAGCGAATGATTAGTCGTC
GCTTAGCTTTACTCTAGAGTCGAGGCTTAGCTCAAGGAGTGGCTATGGCATTCAACGGTGTTCGTATGCTTGATG
TAACAGGACTACGGAAAACTTACATATTCGCATCAGCTTGGCCAAGGTCTCGGAGGTCCTTTTGGGGGAATAGTC
ACAGATTGGTTCGTATGCTTGCATTATGCTGAGTGCGCAACCAACCAACCGCTTTGTTTCATAGGCTAGGATGGA
GATGGGCGTTTCTCCTTCAGATCCCGCTATTTGCTCTGGCATACGTTTTGACAGACTATAACCTGTGTTACGTTA
CAGAAGTAATAATTCATTCTACATCACTGTTGGATTGCGGTGCTCACATTTCTTTGCAGGGGAAAGGAAAGAGTA
CAAAAGAGGTTTTAAAAAGAATCGACTATGGTGGTAGTGTGGCGTTGATGTCTTTTGTACGCTCAAAGTCCCAAA
TCGTGATATCTCTTTCGTCCTCGACTCACCTTTACCTTGCTTCCAGGTCGGATCAATTCTTTTTTTCCTTAGTGA
ACGTTTCAACCAGAATCTGCCCGTAGGTCTTACCAATATTCTCCTCTAATATATTAGCTCATATTTGACCCGCAG
TGGGGTAGCCCGACTGTGGTCGGTTCCATCGCGGCTGCCATCGTTTCGATAATCACCTTCCTGGTTATCGAGTTG
TATATCGCTCCCGAGCCAATTATGGCACCCTATATCCTAAAGCAAAGGATACCCCGTCTCGTTGGCGCATCAAAT
TTCCTGGTTGCGAACTGCAACCTTACTGTTATGTACTTCTTCCCTCTCTGGTTCCAGACTGTAATGCTGTCGAAT
GCATCAACCGCTGGTAAGGAATCTTATCCTTACAATCGATCCGTTGGCCCCTGTTTGACTCTGGACTAGGCGCCC
ATCTTTTACCCAACAGCCTTGCTGTGTCTGCTGGTTCGTTGTTTGCCGGATGGATAATGTACACAACGGGAAAGT
ATAAGCGATTAAACTCTATGACTGGTATCTTGCCCTTCATCGGGGTGGTTGGTATCTTGATGATCAATGAGAACT
CGGGCATCGTTCAGTCATGGTTCAGCGTTGTACGTGTGCCCATTGCTACTACGAAATTTTAGCCTGACCACCCCT
TTTAATATAGATACCTGTTGGGTTTGGCAATGCCATTGCAATGCAAACTTCGCTCAGTGAGTTCAAATGTATTGT
TTGTGATTTTTCATCTACCTACTATTATTTCGTTAGTTGCATTACTGGCCCATCTTCCAGGTGCGGACGTCTTGC
GGAAGACAGTTTTTTTTCTTTCTAACTATTAATCTTAGAAAATCATGTGGCACTAGGGACAGGATTTGGCACTCT
ATTCCGAGGAGTTGGTATGTCGCTTCTCGAACTTGCTGCCTTTCCCATGCTAATGTATCCGACACGCAGGCCAAG
TTGGAGGAGTGGCAATATCATCAGCTATTTTCCAATCCAGACTCACACGCGAGCTTCACACACGGATAACAGGTC
CAAATGCCGAGGAGGTAAACTGTCTCGTCTCTTCTCATGGAATTTTCCCTGATGCACCACTCAGCTTATCACAAG
AATAAAACAACAATCTAATCTTGTAGTTTCACTCCCACCTGACGTTCAACGAGCCGTTCGAGACGCCCATTCTAC
GAGTATAAAGGCTGTGTTCGTTTACGCTGCATGTTTGACACTGGTATCCTACGCCGTCCGTCTTGCTGTGAGTGT
TAACAACCTTTCTCTTTTGTTCGTGTCTTAATTCTGACCTTCTGTGATAGATACCCGAGAAGGAGCTTGATTCGC
GCCCAAGCATCGCTGAACCTCCAGAGGTTTCCCTCCCAGCTGATGATGAATCAGAACGAGAAGGGAGCGTGGCAT
CGTTAGAAACCGATGTAGTCGTGGTGAGGGACGAGGGTGGACAGAAGCACGAAATATCAGCGAAGGTTGCAAATA
TTCTATTCGACCTTGACAAGGCGAAGAAGGCAGATTCTGAATTTGGATCTGCGAAGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail