Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|064780
Gene name
Locationscaffold_3:2943219..2944789
Strand+
Gene length (bp)1570
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 4.2E-23 181 373

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 99 469 7.0E-39
sp|Q9P0J1|PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens GN=PDP1 PE=1 SV=3 155 468 1.0E-22
sp|Q5RA52|PDP1_PONAB [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Pongo abelii GN=PDP1 PE=2 SV=1 155 468 1.0E-22
sp|O88483|PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus GN=Pdp1 PE=1 SV=1 155 468 3.0E-22
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 155 468 4.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 99 469 7.0E-39
sp|Q9P0J1|PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens GN=PDP1 PE=1 SV=3 155 468 1.0E-22
sp|Q5RA52|PDP1_PONAB [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Pongo abelii GN=PDP1 PE=2 SV=1 155 468 1.0E-22
sp|O88483|PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus GN=Pdp1 PE=1 SV=1 155 468 3.0E-22
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 155 468 4.0E-22
sp|P35816|PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus GN=PDP1 PE=1 SV=1 155 468 1.0E-21
sp|Q9P2J9|PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens GN=PDP2 PE=2 SV=2 158 468 1.0E-20
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 159 468 3.0E-20
sp|O88484|PDP2_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Rattus norvegicus GN=Pdp2 PE=2 SV=1 155 468 8.0E-20
sp|Q5PNS9|P2C64_ARATH Probable protein phosphatase 2C 64 OS=Arabidopsis thaliana GN=At4g38520 PE=2 SV=1 154 366 1.0E-11
sp|Q9LHJ9|P2C38_ARATH Probable protein phosphatase 2C 38 OS=Arabidopsis thaliana GN=At3g12620 PE=2 SV=1 215 382 4.0E-10
sp|Q94CL8|P2C48_ARATH Probable protein phosphatase 2C 48 OS=Arabidopsis thaliana GN=PP2C6 PE=2 SV=1 215 366 8.0E-10
sp|Q7Y138|P2C36_ORYSJ Probable protein phosphatase 2C 36 OS=Oryza sativa subsp. japonica GN=Os03g0832400 PE=2 SV=1 122 366 1.0E-09
sp|Q10S32|P2C28_ORYSJ Probable protein phosphatase 2C 28 OS=Oryza sativa subsp. japonica GN=Os03g0137200 PE=2 SV=1 216 382 2.0E-09
sp|Q8H063|P2C29_ORYSJ Probable protein phosphatase 2C 29 OS=Oryza sativa subsp. japonica GN=Os03g0207400 PE=2 SV=1 216 366 6.0E-09
sp|Q2QN36|P2C78_ORYSJ Probable protein phosphatase 2C 78 OS=Oryza sativa subsp. japonica GN=Os12g0580900 PE=2 SV=1 215 366 9.0E-09
sp|Q10NB9|P2C31_ORYSJ Probable protein phosphatase 2C 31 OS=Oryza sativa subsp. japonica GN=Os03g0275100 PE=2 SV=1 220 373 3.0E-08
sp|Q501F9|P2C67_ARATH Probable protein phosphatase 2C 67 OS=Arabidopsis thaliana GN=At5g02760 PE=2 SV=1 96 366 9.0E-08
sp|Q94H98|P2C34_ORYSJ Probable protein phosphatase 2C 34 OS=Oryza sativa subsp. japonica GN=BIPP2C2 PE=2 SV=1 89 383 9.0E-08
sp|Q5MFV5|P2C34_ORYSI Probable protein phosphatase 2C 34 OS=Oryza sativa subsp. indica GN=BIPP2C2 PE=2 SV=2 89 383 9.0E-08
sp|Q6Z8B9|P2C12_ORYSJ Probable protein phosphatase 2C 12 OS=Oryza sativa subsp. japonica GN=Os02g0224100 PE=2 SV=1 195 366 1.0E-07
sp|Q3EAF9|P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana GN=At3g62260 PE=2 SV=1 157 374 1.0E-07
sp|Q9LQN6|P2C04_ARATH Probable protein phosphatase 2C 4 OS=Arabidopsis thaliana GN=PLL5 PE=2 SV=1 164 373 2.0E-07
sp|Q84T94|P2C35_ORYSJ Protein phosphatase 2C 35 OS=Oryza sativa subsp. japonica GN=XB15 PE=1 SV=1 216 371 2.0E-07
sp|Q9ZV25|P2C23_ARATH Probable protein phosphatase 2C 23 OS=Arabidopsis thaliana GN=PLL4 PE=2 SV=1 218 373 6.0E-07
sp|Q9SR24|P2C36_ARATH Probable protein phosphatase 2C 36 OS=Arabidopsis thaliana GN=PLL3 PE=2 SV=1 218 371 1.0E-06
sp|Q84JD5|P2C68_ARATH Probable protein phosphatase 2C 68 OS=Arabidopsis thaliana GN=At5g06750 PE=2 SV=1 216 382 1.0E-06
sp|Q0V7V2|P2C42_ARATH Probable protein phosphatase 2C 42 OS=Arabidopsis thaliana GN=At3g17090 PE=2 SV=1 145 366 2.0E-06
sp|Q7XVF9|P2C39_ORYSJ Probable protein phosphatase 2C 39 OS=Oryza sativa subsp. japonica GN=Os04g0403701 PE=2 SV=2 216 366 8.0E-06
sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 201 370 8.0E-06
sp|Q7XHN8|P2C61_ORYSJ Probable protein phosphatase 2C 61 OS=Oryza sativa subsp. japonica GN=Os07g0114000 PE=2 SV=1 163 366 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004721 phosphoprotein phosphatase activity No
GO:0042578 phosphoric ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 23.35 12.94 33.77
Initials Initials knots 27.89 15.73 40.06
Pileal_Stipeal_center Stage I stipe center 30.42 17.39 43.44
Pileal_Stipeal_shell Stage I stipe shell 29.33 16.69 41.97
DIF_stipe_center Stage II stipe center 34.23 19.65 48.82
DIF_stipe_shell Stage II stipe shell 35.39 20.53 50.26
DIF_stipe_skin Stage II stipe skin 31.72 18.18 45.25
DIF_cap_skin Stage II cap skin 30.08 17.16 43.01
DIF_cap_tissue Stage II cap tissue 33.79 19.44 48.13
DIF_gill_tissue Stage II gill tissue 33.56 19.35 47.78
YFB_stipe_center Young fruiting body stipe center 31.82 18.30 45.34
YFB_stipe_shell Young fruiting body stipe shell 32.70 18.81 46.58
YFB_stipe_skin Young fruiting body stipe skin 27.22 15.37 39.07
YFB_cap_skin Young fruiting body cap skin 24.12 13.38 34.86
YFB_cap_tissue Young fruiting body cap tissue 31.75 18.23 45.27
YFB_gill_tissue Young fruiting body gill tissue 23.09 12.81 33.37
YFB_veil Young fruiting body veil 25.60 14.37 36.84

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.276718 no
Casing YFB_stipe_center 0.384811 no
Casing YFB_stipe_shell 0.328346 no
Casing YFB_stipe_skin 0.738899 no
Casing YFB_cap_skin 0.957799 no
Casing YFB_cap_tissue 0.385302 no
Casing YFB_gill_tissue 0.985315 no
Casing YFB_veil 0.859830 no
Casing Initials 0.684684 no
Casing Pileal_Stipeal_center 0.484539 no
Casing Pileal_Stipeal_shell 0.559077 no
Casing DIF_stipe_center 0.247691 no
Casing DIF_stipe_shell 0.182806 no
Casing DIF_stipe_skin 0.388159 no
Casing DIF_cap_skin 0.503774 no
Casing DIF_cap_tissue 0.269957 no
DIF_gill_tissue YFB_stipe_center 0.927433 no
DIF_gill_tissue YFB_stipe_shell 0.963965 no
DIF_gill_tissue YFB_stipe_skin 0.606904 no
DIF_gill_tissue YFB_cap_skin 0.341228 no
DIF_gill_tissue YFB_cap_tissue 0.921246 no
DIF_gill_tissue YFB_gill_tissue 0.260392 no
DIF_gill_tissue YFB_veil 0.461599 no
YFB_stipe_center YFB_stipe_shell 0.962070 no
YFB_stipe_center YFB_stipe_skin 0.729483 no
YFB_stipe_center YFB_cap_skin 0.453704 no
YFB_stipe_center YFB_cap_tissue 0.996207 no
YFB_stipe_center YFB_gill_tissue 0.364683 no
YFB_stipe_center YFB_veil 0.586660 no
YFB_stipe_shell YFB_stipe_skin 0.667525 no
YFB_stipe_shell YFB_cap_skin 0.395737 no
YFB_stipe_shell YFB_cap_tissue 0.959412 no
YFB_stipe_shell YFB_gill_tissue 0.311077 no
YFB_stipe_shell YFB_veil 0.522406 no
YFB_stipe_skin YFB_cap_skin 0.808298 no
YFB_stipe_skin YFB_cap_tissue 0.733997 no
YFB_stipe_skin YFB_gill_tissue 0.719950 no
YFB_stipe_skin YFB_veil 0.913230 no
YFB_cap_skin YFB_cap_tissue 0.456532 no
YFB_cap_skin YFB_gill_tissue 0.941189 no
YFB_cap_skin YFB_veil 0.917073 no
YFB_cap_tissue YFB_gill_tissue 0.370828 no
YFB_cap_tissue YFB_veil 0.587986 no
YFB_gill_tissue YFB_veil 0.843211 no
Initials DIF_gill_tissue 0.660130 no
Initials YFB_stipe_center 0.781617 no
Initials YFB_stipe_shell 0.718377 no
Initials YFB_stipe_skin 0.967953 no
Initials YFB_cap_skin 0.756583 no
Initials YFB_cap_tissue 0.781287 no
Initials YFB_gill_tissue 0.662082 no
Initials YFB_veil 0.871145 no
Initials Pileal_Stipeal_center 0.869978 no
Initials Pileal_Stipeal_shell 0.927680 no
Initials DIF_stipe_center 0.616688 no
Initials DIF_stipe_shell 0.530604 no
Initials DIF_stipe_skin 0.789367 no
Initials DIF_cap_skin 0.887593 no
Initials DIF_cap_tissue 0.650344 no
Pileal_Stipeal_center DIF_gill_tissue 0.843891 no
Pileal_Stipeal_center YFB_stipe_center 0.938489 no
Pileal_Stipeal_center YFB_stipe_shell 0.891074 no
Pileal_Stipeal_center YFB_stipe_skin 0.822869 no
Pileal_Stipeal_center YFB_cap_skin 0.554344 no
Pileal_Stipeal_center YFB_cap_tissue 0.939143 no
Pileal_Stipeal_center YFB_gill_tissue 0.455342 no
Pileal_Stipeal_center YFB_veil 0.687526 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.948233 no
Pileal_Stipeal_center DIF_stipe_center 0.805696 no
Pileal_Stipeal_center DIF_stipe_shell 0.726472 no
Pileal_Stipeal_center DIF_stipe_skin 0.942194 no
Pileal_Stipeal_center DIF_cap_skin 0.984583 no
Pileal_Stipeal_center DIF_cap_tissue 0.831594 no
Pileal_Stipeal_shell DIF_gill_tissue 0.766966 no
Pileal_Stipeal_shell YFB_stipe_center 0.877610 no
Pileal_Stipeal_shell YFB_stipe_shell 0.821957 no
Pileal_Stipeal_shell YFB_stipe_skin 0.889808 no
Pileal_Stipeal_shell YFB_cap_skin 0.637102 no
Pileal_Stipeal_shell YFB_cap_tissue 0.878007 no
Pileal_Stipeal_shell YFB_gill_tissue 0.539363 no
Pileal_Stipeal_shell YFB_veil 0.769464 no
Pileal_Stipeal_shell DIF_stipe_center 0.726406 no
Pileal_Stipeal_shell DIF_stipe_shell 0.641031 no
Pileal_Stipeal_shell DIF_stipe_skin 0.883616 no
Pileal_Stipeal_shell DIF_cap_skin 0.964272 no
Pileal_Stipeal_shell DIF_cap_tissue 0.754946 no
DIF_stipe_center DIF_gill_tissue 0.973108 no
DIF_stipe_center YFB_stipe_center 0.892968 no
DIF_stipe_center YFB_stipe_shell 0.935143 no
DIF_stipe_center YFB_stipe_skin 0.561775 no
DIF_stipe_center YFB_cap_skin 0.305510 no
DIF_stipe_center YFB_cap_tissue 0.885120 no
DIF_stipe_center YFB_gill_tissue 0.231439 no
DIF_stipe_center YFB_veil 0.418743 no
DIF_stipe_center DIF_stipe_shell 0.952071 no
DIF_stipe_center DIF_stipe_skin 0.887809 no
DIF_stipe_center DIF_cap_skin 0.781483 no
DIF_stipe_center DIF_cap_tissue 0.982231 no
DIF_stipe_shell DIF_gill_tissue 0.924576 no
DIF_stipe_shell YFB_stipe_center 0.825780 no
DIF_stipe_shell YFB_stipe_shell 0.877242 no
DIF_stipe_shell YFB_stipe_skin 0.467805 no
DIF_stipe_shell YFB_cap_skin 0.230883 no
DIF_stipe_shell YFB_cap_tissue 0.817852 no
DIF_stipe_shell YFB_gill_tissue 0.169839 no
DIF_stipe_shell YFB_veil 0.330998 no
DIF_stipe_shell DIF_stipe_skin 0.820114 no
DIF_stipe_shell DIF_cap_skin 0.697569 no
DIF_stipe_shell DIF_cap_tissue 0.933943 no
DIF_stipe_skin DIF_gill_tissue 0.919488 no
DIF_stipe_skin YFB_stipe_center 0.995232 no
DIF_stipe_skin YFB_stipe_shell 0.958545 no
DIF_stipe_skin YFB_stipe_skin 0.735132 no
DIF_stipe_skin YFB_cap_skin 0.459466 no
DIF_stipe_skin YFB_cap_tissue 0.998270 no
DIF_stipe_skin YFB_gill_tissue 0.370918 no
DIF_stipe_skin YFB_veil 0.592080 no
DIF_stipe_skin DIF_cap_skin 0.924025 no
DIF_stipe_skin DIF_cap_tissue 0.907006 no
DIF_cap_skin DIF_gill_tissue 0.823506 no
DIF_cap_skin YFB_stipe_center 0.921575 no
DIF_cap_skin YFB_stipe_shell 0.872221 no
DIF_cap_skin YFB_stipe_skin 0.845369 no
DIF_cap_skin YFB_cap_skin 0.578072 no
DIF_cap_skin YFB_cap_tissue 0.922536 no
DIF_cap_skin YFB_gill_tissue 0.478395 no
DIF_cap_skin YFB_veil 0.711493 no
DIF_cap_skin DIF_cap_tissue 0.810956 no
DIF_cap_tissue DIF_gill_tissue 0.990540 no
DIF_cap_tissue YFB_stipe_center 0.913662 no
DIF_cap_tissue YFB_stipe_shell 0.953843 no
DIF_cap_tissue YFB_stipe_skin 0.586921 no
DIF_cap_tissue YFB_cap_skin 0.325695 no
DIF_cap_tissue YFB_cap_tissue 0.907585 no
DIF_cap_tissue YFB_gill_tissue 0.251432 no
DIF_cap_tissue YFB_veil 0.444068 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|064780
MAWVTGRRSLLFLTGVASFGGSLYYRETNNRADNHQDDACNIPSQRTFDSFANHIWSGSQVDERNDKIVTRYSSA
YLANKGIGFCSLGFYRTELAPQQNWTFGLLGEGFRGWETSAFIFRALTPTICAVLSLALGKNASRPGKEDLSTEP
EPPITSEKIDMSIKKAFLDVDHGVVDQAPDMIISSPSQALNMVQLSAAVSGSTGMLAVYDESRRILKVANVGDAR
AVLGRKAMHENGMPCFEVHVLSSEHTSSNPSELARLQESHSDTDIKVLQEYVERDITRAFGLAMCKWSQSLQDRI
YRDYLGESPLVNLLLRSTSDPENQQQPYLNAEPDIRTIHVRPGDFLVMASKGVWDSLANEEVIGLVGVWLAQQNC
NPRTPISHPSLENIYDQNMLPVKFPEKWEDATTWYQKMKIQKKYICVDTNVAAHLVRNALGGANQAFTEGVLRLP
YPLSACSRGELAVMVLQFE*
Coding >AgabiH97|064780
ATGGCTTGGGTGACTGGGCGACGTTCTCTCCTTTTCTTGACAGGTGTTGCTTCATTTGGTGGATCCCTATACTAT
CGAGAAACCAATAATCGCGCCGACAACCATCAGGATGATGCATGTAACATTCCATCCCAGAGAACGTTCGACTCA
TTTGCGAATCATATATGGTCCGGCAGTCAGGTTGATGAACGGAACGATAAAATTGTTACCAGGTACAGCTCTGCC
TATCTGGCCAATAAAGGGATTGGGTTTTGCAGTTTAGGTTTTTATCGTACCGAGTTGGCGCCTCAACAAAACTGG
ACGTTTGGTCTTCTGGGCGAAGGTTTCAGAGGCTGGGAAACTAGCGCCTTCATATTCAGAGCCCTTACACCCACA
ATATGTGCAGTGCTCAGTTTAGCGCTGGGTAAAAATGCCTCTCGTCCTGGTAAGGAGGATCTCTCCACAGAGCCC
GAGCCTCCAATCACCTCTGAAAAAATCGATATGTCGATCAAAAAGGCTTTTCTAGATGTTGACCATGGAGTGGTG
GACCAGGCGCCAGACATGATCATATCATCTCCTTCTCAAGCTCTTAATATGGTCCAACTGTCTGCTGCTGTCTCA
GGAAGCACCGGAATGTTGGCGGTATATGATGAGTCGAGGCGTATCCTCAAAGTTGCAAACGTTGGAGATGCACGC
GCCGTCTTAGGCCGTAAAGCAATGCATGAAAACGGTATGCCATGCTTCGAGGTTCACGTCCTCAGTTCCGAACAC
ACATCTTCCAACCCTTCTGAACTGGCGCGCCTTCAGGAATCTCACTCCGACACTGACATAAAAGTTCTTCAGGAA
TACGTTGAGCGGGACATCACTCGTGCATTCGGCTTAGCTATGTGTAAATGGAGTCAAAGCTTGCAGGACCGAATT
TATCGAGATTATCTTGGCGAATCTCCATTAGTCAATCTTCTCCTTCGATCGACCTCTGATCCAGAGAATCAGCAG
CAACCGTACCTCAATGCTGAACCCGATATAAGGACGATTCATGTCCGGCCTGGTGATTTTCTTGTCATGGCCAGC
AAGGGTGTTTGGGATTCTCTTGCGAATGAGGAAGTCATTGGCCTCGTCGGCGTATGGTTGGCGCAACAGAACTGT
AATCCCCGAACTCCGATTTCACATCCCTCCTTGGAGAACATTTATGATCAGAATATGTTACCTGTGAAGTTCCCT
GAGAAATGGGAAGACGCAACAACCTGGTACCAGAAGATGAAGATTCAGAAGAAATATATCTGTGTTGACACCAAC
GTTGCAGCCCATCTTGTCCGTAATGCACTGGGAGGCGCGAACCAAGCCTTCACTGAAGGAGTTTTAAGGCTGCCA
TACCCTTTGTCTGCATGTAGTCGTGGCGAATTGGCGGTGATGGTCCTTCAATTCGAATGA
Transcript >AgabiH97|064780
ATGGCTTGGGTGACTGGGCGACGTTCTCTCCTTTTCTTGACAGGTGTTGCTTCATTTGGTGGATCCCTATACTAT
CGAGAAACCAATAATCGCGCCGACAACCATCAGGATGATGCATGTAACATTCCATCCCAGAGAACGTTCGACTCA
TTTGCGAATCATATATGGTCCGGCAGTCAGGTTGATGAACGGAACGATAAAATTGTTACCAGGTACAGCTCTGCC
TATCTGGCCAATAAAGGGATTGGGTTTTGCAGTTTAGGTTTTTATCGTACCGAGTTGGCGCCTCAACAAAACTGG
ACGTTTGGTCTTCTGGGCGAAGGTTTCAGAGGCTGGGAAACTAGCGCCTTCATATTCAGAGCCCTTACACCCACA
ATATGTGCAGTGCTCAGTTTAGCGCTGGGTAAAAATGCCTCTCGTCCTGGTAAGGAGGATCTCTCCACAGAGCCC
GAGCCTCCAATCACCTCTGAAAAAATCGATATGTCGATCAAAAAGGCTTTTCTAGATGTTGACCATGGAGTGGTG
GACCAGGCGCCAGACATGATCATATCATCTCCTTCTCAAGCTCTTAATATGGTCCAACTGTCTGCTGCTGTCTCA
GGAAGCACCGGAATGTTGGCGGTATATGATGAGTCGAGGCGTATCCTCAAAGTTGCAAACGTTGGAGATGCACGC
GCCGTCTTAGGCCGTAAAGCAATGCATGAAAACGGTATGCCATGCTTCGAGGTTCACGTCCTCAGTTCCGAACAC
ACATCTTCCAACCCTTCTGAACTGGCGCGCCTTCAGGAATCTCACTCCGACACTGACATAAAAGTTCTTCAGGAA
TACGTTGAGCGGGACATCACTCGTGCATTCGGCTTAGCTATGTGTAAATGGAGTCAAAGCTTGCAGGACCGAATT
TATCGAGATTATCTTGGCGAATCTCCATTAGTCAATCTTCTCCTTCGATCGACCTCTGATCCAGAGAATCAGCAG
CAACCGTACCTCAATGCTGAACCCGATATAAGGACGATTCATGTCCGGCCTGGTGATTTTCTTGTCATGGCCAGC
AAGGGTGTTTGGGATTCTCTTGCGAATGAGGAAGTCATTGGCCTCGTCGGCGTATGGTTGGCGCAACAGAACTGT
AATCCCCGAACTCCGATTTCACATCCCTCCTTGGAGAACATTTATGATCAGAATATGTTACCTGTGAAGTTCCCT
GAGAAATGGGAAGACGCAACAACCTGGTACCAGAAGATGAAGATTCAGAAGAAATATATCTGTGTTGACACCAAC
GTTGCAGCCCATCTTGTCCGTAATGCACTGGGAGGCGCGAACCAAGCCTTCACTGAAGGAGTTTTAAGGCTGCCA
TACCCTTTGTCTGCATGTAGTCGTGGCGAATTGGCGGTGATGGTCCTTCAATTCGAATGA
Gene >AgabiH97|064780
ATGGCTTGGGTGACTGGGCGACGTTCTCTCCTTTTCTTGACAGGTGTTGCTTCATTTGGTGGATCCCTATACTAT
CGAGAAACCAATAATCGCGCCGACAACCATCAGGATGATGCATGTAACATTCCATCCCAGAGAAGTGAGTTAGCA
TTGACCGTAAGCATGCAGTGACGCGCAACTGATGGTAAGCTCATAGCGTTCGACTCATTTGCGAATCATATATGG
TCCGGCAGTCAGGTTGATGAACGGAACGATAAAATTGTTACCAGGTACAGCTCTGCCTATCTGGCCAAGTGCGTC
CTTCACCTTATCCCCCCACCAGCTGCACATCTAACCTTTCTTAGTAAAGGGATTGGGTTTTGCAGTTTAGGTTTT
TATCGTACCGAGTTGGCGCCTCAACAAAACTGGACGTTTGGTCTTCTGGGCGAAGGTTTCAGAGGCTGGGAAACT
AGCGCCTTCATATTCAGAGCCCTTACACCCACAATATGTGCAGTGCTCAGTTTAGCGCTGGGTAAAAATGCCTCT
CGTCCTGGTAAGGAGGATCTCTCCACAGAGCCCGAGCCTCCAATCACCTCTGAAAAAATCGATATGTCGATCAAA
AAGGCTTTTCTAGATGTTGACCATGGAGTGGTGGACCAGGCGCCAGACATGATCATATCATCTCCTTCTCAAGCT
CTTAATATGGTCCAACTGTCTGCTGCTGTCTCAGGAAGCACCGGAATGTTGGCGGTATATGATGAGTCGAGGCGT
ATCCTCAAAGTTGCAAACGTTGGAGATGCACGCGCCGTCTTAGGCCGTAAAGCAATGCATGAAAACGGTATGCCA
TGCTTCGAGGTTCACGTCCTCAGTTCCGAACACACATCTTCCAACCCTTCTGAACTGGCGCGCCTTCAGGAATCT
CACTCCGACACTGACATAAAAGTTCTTCAGGAATACGTTGAGCGGGACATCACTCGTGCATTCGGCTTAGCTATG
TGTAAATGGAGTCAAAGCTTGCAGGACCGAATTTATCGAGATTATCTTGGCGAATCTCCATTAGTCAATCTTCTC
CTTCGATCGACCTCTGATCCAGAGAATCAGCAGCAACCGTACCTCAATGCTGAACCCGATATAAGGACGATTCAT
GTCCGGCCTGGTGATTTTCTTGTCATGGCCAGCAAGGGTGTTTGGGATTCTCTTGCGAATGAGGAAGTCATTGGC
CTCGTCGGCGTATGGTTGGCGCAACAGAACTGTAATCCCCGAACTCCGATTTCACATCCCTCCTTGGAGAACATT
TATGATCAGAATATGTTACCTGTGAAGTTCCCTGAGAAATGGGAAGACGCAACAACCTGGTACCAGAAGATGAAG
ATTCAGAAGAAATATATCTGTGTTGACACCAACGTTGCAGCCCATCTTGTCCGTAATGCACTGGGAGGCGCGAAC
CAAGCCTTCACTGAAGGAGTTTTAAGGCTGCCATACCCTTTGTCTGCATGTAGTCGGTACGTAGTTATTTCTGTG
GCTGCCGAGATCAGCGATAACACATCGTTACAGTGGCGAATTGGCGGTGATGGTCCTTCAATTCGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail