Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|064780
Gene name
Locationscaffold_3:2943219..2944789
Strand+
Gene length (bp)1570
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 4.2E-23 181 373

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 99 469 7.0E-39
sp|Q9P0J1|PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens GN=PDP1 PE=1 SV=3 155 468 1.0E-22
sp|Q5RA52|PDP1_PONAB [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Pongo abelii GN=PDP1 PE=2 SV=1 155 468 1.0E-22
sp|O88483|PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus GN=Pdp1 PE=1 SV=1 155 468 3.0E-22
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 155 468 4.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 99 469 7.0E-39
sp|Q9P0J1|PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens GN=PDP1 PE=1 SV=3 155 468 1.0E-22
sp|Q5RA52|PDP1_PONAB [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Pongo abelii GN=PDP1 PE=2 SV=1 155 468 1.0E-22
sp|O88483|PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus GN=Pdp1 PE=1 SV=1 155 468 3.0E-22
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 155 468 4.0E-22
sp|P35816|PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus GN=PDP1 PE=1 SV=1 155 468 1.0E-21
sp|Q9P2J9|PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens GN=PDP2 PE=2 SV=2 158 468 1.0E-20
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 159 468 3.0E-20
sp|O88484|PDP2_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Rattus norvegicus GN=Pdp2 PE=2 SV=1 155 468 8.0E-20
sp|Q5PNS9|P2C64_ARATH Probable protein phosphatase 2C 64 OS=Arabidopsis thaliana GN=At4g38520 PE=2 SV=1 154 366 1.0E-11
sp|Q9LHJ9|P2C38_ARATH Probable protein phosphatase 2C 38 OS=Arabidopsis thaliana GN=At3g12620 PE=2 SV=1 215 382 4.0E-10
sp|Q94CL8|P2C48_ARATH Probable protein phosphatase 2C 48 OS=Arabidopsis thaliana GN=PP2C6 PE=2 SV=1 215 366 8.0E-10
sp|Q7Y138|P2C36_ORYSJ Probable protein phosphatase 2C 36 OS=Oryza sativa subsp. japonica GN=Os03g0832400 PE=2 SV=1 122 366 1.0E-09
sp|Q10S32|P2C28_ORYSJ Probable protein phosphatase 2C 28 OS=Oryza sativa subsp. japonica GN=Os03g0137200 PE=2 SV=1 216 382 2.0E-09
sp|Q8H063|P2C29_ORYSJ Probable protein phosphatase 2C 29 OS=Oryza sativa subsp. japonica GN=Os03g0207400 PE=2 SV=1 216 366 6.0E-09
sp|Q2QN36|P2C78_ORYSJ Probable protein phosphatase 2C 78 OS=Oryza sativa subsp. japonica GN=Os12g0580900 PE=2 SV=1 215 366 9.0E-09
sp|Q10NB9|P2C31_ORYSJ Probable protein phosphatase 2C 31 OS=Oryza sativa subsp. japonica GN=Os03g0275100 PE=2 SV=1 220 373 3.0E-08
sp|Q501F9|P2C67_ARATH Probable protein phosphatase 2C 67 OS=Arabidopsis thaliana GN=At5g02760 PE=2 SV=1 96 366 9.0E-08
sp|Q94H98|P2C34_ORYSJ Probable protein phosphatase 2C 34 OS=Oryza sativa subsp. japonica GN=BIPP2C2 PE=2 SV=1 89 383 9.0E-08
sp|Q5MFV5|P2C34_ORYSI Probable protein phosphatase 2C 34 OS=Oryza sativa subsp. indica GN=BIPP2C2 PE=2 SV=2 89 383 9.0E-08
sp|Q6Z8B9|P2C12_ORYSJ Probable protein phosphatase 2C 12 OS=Oryza sativa subsp. japonica GN=Os02g0224100 PE=2 SV=1 195 366 1.0E-07
sp|Q3EAF9|P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana GN=At3g62260 PE=2 SV=1 157 374 1.0E-07
sp|Q9LQN6|P2C04_ARATH Probable protein phosphatase 2C 4 OS=Arabidopsis thaliana GN=PLL5 PE=2 SV=1 164 373 2.0E-07
sp|Q84T94|P2C35_ORYSJ Protein phosphatase 2C 35 OS=Oryza sativa subsp. japonica GN=XB15 PE=1 SV=1 216 371 2.0E-07
sp|Q9ZV25|P2C23_ARATH Probable protein phosphatase 2C 23 OS=Arabidopsis thaliana GN=PLL4 PE=2 SV=1 218 373 6.0E-07
sp|Q9SR24|P2C36_ARATH Probable protein phosphatase 2C 36 OS=Arabidopsis thaliana GN=PLL3 PE=2 SV=1 218 371 1.0E-06
sp|Q84JD5|P2C68_ARATH Probable protein phosphatase 2C 68 OS=Arabidopsis thaliana GN=At5g06750 PE=2 SV=1 216 382 1.0E-06
sp|Q0V7V2|P2C42_ARATH Probable protein phosphatase 2C 42 OS=Arabidopsis thaliana GN=At3g17090 PE=2 SV=1 145 366 2.0E-06
sp|Q7XVF9|P2C39_ORYSJ Probable protein phosphatase 2C 39 OS=Oryza sativa subsp. japonica GN=Os04g0403701 PE=2 SV=2 216 366 8.0E-06
sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 201 370 8.0E-06
sp|Q7XHN8|P2C61_ORYSJ Probable protein phosphatase 2C 61 OS=Oryza sativa subsp. japonica GN=Os07g0114000 PE=2 SV=1 163 366 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004721 phosphoprotein phosphatase activity No
GO:0042578 phosphoric ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|064780
MAWVTGRRSLLFLTGVASFGGSLYYRETNNRADNHQDDACNIPSQRTFDSFANHIWSGSQVDERNDKIVTRYSSA
YLANKGIGFCSLGFYRTELAPQQNWTFGLLGEGFRGWETSAFIFRALTPTICAVLSLALGKNASRPGKEDLSTEP
EPPITSEKIDMSIKKAFLDVDHGVVDQAPDMIISSPSQALNMVQLSAAVSGSTGMLAVYDESRRILKVANVGDAR
AVLGRKAMHENGMPCFEVHVLSSEHTSSNPSELARLQESHSDTDIKVLQEYVERDITRAFGLAMCKWSQSLQDRI
YRDYLGESPLVNLLLRSTSDPENQQQPYLNAEPDIRTIHVRPGDFLVMASKGVWDSLANEEVIGLVGVWLAQQNC
NPRTPISHPSLENIYDQNMLPVKFPEKWEDATTWYQKMKIQKKYICVDTNVAAHLVRNALGGANQAFTEGVLRLP
YPLSACSRGELAVMVLQFE*
Coding >AgabiH97|064780
ATGGCTTGGGTGACTGGGCGACGTTCTCTCCTTTTCTTGACAGGTGTTGCTTCATTTGGTGGATCCCTATACTAT
CGAGAAACCAATAATCGCGCCGACAACCATCAGGATGATGCATGTAACATTCCATCCCAGAGAACGTTCGACTCA
TTTGCGAATCATATATGGTCCGGCAGTCAGGTTGATGAACGGAACGATAAAATTGTTACCAGGTACAGCTCTGCC
TATCTGGCCAATAAAGGGATTGGGTTTTGCAGTTTAGGTTTTTATCGTACCGAGTTGGCGCCTCAACAAAACTGG
ACGTTTGGTCTTCTGGGCGAAGGTTTCAGAGGCTGGGAAACTAGCGCCTTCATATTCAGAGCCCTTACACCCACA
ATATGTGCAGTGCTCAGTTTAGCGCTGGGTAAAAATGCCTCTCGTCCTGGTAAGGAGGATCTCTCCACAGAGCCC
GAGCCTCCAATCACCTCTGAAAAAATCGATATGTCGATCAAAAAGGCTTTTCTAGATGTTGACCATGGAGTGGTG
GACCAGGCGCCAGACATGATCATATCATCTCCTTCTCAAGCTCTTAATATGGTCCAACTGTCTGCTGCTGTCTCA
GGAAGCACCGGAATGTTGGCGGTATATGATGAGTCGAGGCGTATCCTCAAAGTTGCAAACGTTGGAGATGCACGC
GCCGTCTTAGGCCGTAAAGCAATGCATGAAAACGGTATGCCATGCTTCGAGGTTCACGTCCTCAGTTCCGAACAC
ACATCTTCCAACCCTTCTGAACTGGCGCGCCTTCAGGAATCTCACTCCGACACTGACATAAAAGTTCTTCAGGAA
TACGTTGAGCGGGACATCACTCGTGCATTCGGCTTAGCTATGTGTAAATGGAGTCAAAGCTTGCAGGACCGAATT
TATCGAGATTATCTTGGCGAATCTCCATTAGTCAATCTTCTCCTTCGATCGACCTCTGATCCAGAGAATCAGCAG
CAACCGTACCTCAATGCTGAACCCGATATAAGGACGATTCATGTCCGGCCTGGTGATTTTCTTGTCATGGCCAGC
AAGGGTGTTTGGGATTCTCTTGCGAATGAGGAAGTCATTGGCCTCGTCGGCGTATGGTTGGCGCAACAGAACTGT
AATCCCCGAACTCCGATTTCACATCCCTCCTTGGAGAACATTTATGATCAGAATATGTTACCTGTGAAGTTCCCT
GAGAAATGGGAAGACGCAACAACCTGGTACCAGAAGATGAAGATTCAGAAGAAATATATCTGTGTTGACACCAAC
GTTGCAGCCCATCTTGTCCGTAATGCACTGGGAGGCGCGAACCAAGCCTTCACTGAAGGAGTTTTAAGGCTGCCA
TACCCTTTGTCTGCATGTAGTCGTGGCGAATTGGCGGTGATGGTCCTTCAATTCGAATGA
Transcript >AgabiH97|064780
ATGGCTTGGGTGACTGGGCGACGTTCTCTCCTTTTCTTGACAGGTGTTGCTTCATTTGGTGGATCCCTATACTAT
CGAGAAACCAATAATCGCGCCGACAACCATCAGGATGATGCATGTAACATTCCATCCCAGAGAACGTTCGACTCA
TTTGCGAATCATATATGGTCCGGCAGTCAGGTTGATGAACGGAACGATAAAATTGTTACCAGGTACAGCTCTGCC
TATCTGGCCAATAAAGGGATTGGGTTTTGCAGTTTAGGTTTTTATCGTACCGAGTTGGCGCCTCAACAAAACTGG
ACGTTTGGTCTTCTGGGCGAAGGTTTCAGAGGCTGGGAAACTAGCGCCTTCATATTCAGAGCCCTTACACCCACA
ATATGTGCAGTGCTCAGTTTAGCGCTGGGTAAAAATGCCTCTCGTCCTGGTAAGGAGGATCTCTCCACAGAGCCC
GAGCCTCCAATCACCTCTGAAAAAATCGATATGTCGATCAAAAAGGCTTTTCTAGATGTTGACCATGGAGTGGTG
GACCAGGCGCCAGACATGATCATATCATCTCCTTCTCAAGCTCTTAATATGGTCCAACTGTCTGCTGCTGTCTCA
GGAAGCACCGGAATGTTGGCGGTATATGATGAGTCGAGGCGTATCCTCAAAGTTGCAAACGTTGGAGATGCACGC
GCCGTCTTAGGCCGTAAAGCAATGCATGAAAACGGTATGCCATGCTTCGAGGTTCACGTCCTCAGTTCCGAACAC
ACATCTTCCAACCCTTCTGAACTGGCGCGCCTTCAGGAATCTCACTCCGACACTGACATAAAAGTTCTTCAGGAA
TACGTTGAGCGGGACATCACTCGTGCATTCGGCTTAGCTATGTGTAAATGGAGTCAAAGCTTGCAGGACCGAATT
TATCGAGATTATCTTGGCGAATCTCCATTAGTCAATCTTCTCCTTCGATCGACCTCTGATCCAGAGAATCAGCAG
CAACCGTACCTCAATGCTGAACCCGATATAAGGACGATTCATGTCCGGCCTGGTGATTTTCTTGTCATGGCCAGC
AAGGGTGTTTGGGATTCTCTTGCGAATGAGGAAGTCATTGGCCTCGTCGGCGTATGGTTGGCGCAACAGAACTGT
AATCCCCGAACTCCGATTTCACATCCCTCCTTGGAGAACATTTATGATCAGAATATGTTACCTGTGAAGTTCCCT
GAGAAATGGGAAGACGCAACAACCTGGTACCAGAAGATGAAGATTCAGAAGAAATATATCTGTGTTGACACCAAC
GTTGCAGCCCATCTTGTCCGTAATGCACTGGGAGGCGCGAACCAAGCCTTCACTGAAGGAGTTTTAAGGCTGCCA
TACCCTTTGTCTGCATGTAGTCGTGGCGAATTGGCGGTGATGGTCCTTCAATTCGAATGA
Gene >AgabiH97|064780
ATGGCTTGGGTGACTGGGCGACGTTCTCTCCTTTTCTTGACAGGTGTTGCTTCATTTGGTGGATCCCTATACTAT
CGAGAAACCAATAATCGCGCCGACAACCATCAGGATGATGCATGTAACATTCCATCCCAGAGAAGTGAGTTAGCA
TTGACCGTAAGCATGCAGTGACGCGCAACTGATGGTAAGCTCATAGCGTTCGACTCATTTGCGAATCATATATGG
TCCGGCAGTCAGGTTGATGAACGGAACGATAAAATTGTTACCAGGTACAGCTCTGCCTATCTGGCCAAGTGCGTC
CTTCACCTTATCCCCCCACCAGCTGCACATCTAACCTTTCTTAGTAAAGGGATTGGGTTTTGCAGTTTAGGTTTT
TATCGTACCGAGTTGGCGCCTCAACAAAACTGGACGTTTGGTCTTCTGGGCGAAGGTTTCAGAGGCTGGGAAACT
AGCGCCTTCATATTCAGAGCCCTTACACCCACAATATGTGCAGTGCTCAGTTTAGCGCTGGGTAAAAATGCCTCT
CGTCCTGGTAAGGAGGATCTCTCCACAGAGCCCGAGCCTCCAATCACCTCTGAAAAAATCGATATGTCGATCAAA
AAGGCTTTTCTAGATGTTGACCATGGAGTGGTGGACCAGGCGCCAGACATGATCATATCATCTCCTTCTCAAGCT
CTTAATATGGTCCAACTGTCTGCTGCTGTCTCAGGAAGCACCGGAATGTTGGCGGTATATGATGAGTCGAGGCGT
ATCCTCAAAGTTGCAAACGTTGGAGATGCACGCGCCGTCTTAGGCCGTAAAGCAATGCATGAAAACGGTATGCCA
TGCTTCGAGGTTCACGTCCTCAGTTCCGAACACACATCTTCCAACCCTTCTGAACTGGCGCGCCTTCAGGAATCT
CACTCCGACACTGACATAAAAGTTCTTCAGGAATACGTTGAGCGGGACATCACTCGTGCATTCGGCTTAGCTATG
TGTAAATGGAGTCAAAGCTTGCAGGACCGAATTTATCGAGATTATCTTGGCGAATCTCCATTAGTCAATCTTCTC
CTTCGATCGACCTCTGATCCAGAGAATCAGCAGCAACCGTACCTCAATGCTGAACCCGATATAAGGACGATTCAT
GTCCGGCCTGGTGATTTTCTTGTCATGGCCAGCAAGGGTGTTTGGGATTCTCTTGCGAATGAGGAAGTCATTGGC
CTCGTCGGCGTATGGTTGGCGCAACAGAACTGTAATCCCCGAACTCCGATTTCACATCCCTCCTTGGAGAACATT
TATGATCAGAATATGTTACCTGTGAAGTTCCCTGAGAAATGGGAAGACGCAACAACCTGGTACCAGAAGATGAAG
ATTCAGAAGAAATATATCTGTGTTGACACCAACGTTGCAGCCCATCTTGTCCGTAATGCACTGGGAGGCGCGAAC
CAAGCCTTCACTGAAGGAGTTTTAAGGCTGCCATACCCTTTGTCTGCATGTAGTCGGTACGTAGTTATTTCTGTG
GCTGCCGAGATCAGCGATAACACATCGTTACAGTGGCGAATTGGCGGTGATGGTCCTTCAATTCGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail