Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|064620
Gene name
Locationscaffold_3:2896386..2898431
Strand-
Gene length (bp)2045
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.4E-09 30 98
PF07690 MFS_1 Major Facilitator Superfamily 7.5E-24 107 361

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 16 165 8.0E-12
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 40 265 3.0E-09
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 108 413 8.0E-08
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 1 413 5.0E-06

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 60 82 22
3 112 134 22
4 141 163 22
5 205 227 22
6 240 262 22
7 284 303 19
8 310 332 22
9 378 400 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|064620
MTNEESPLLHTDVYDRFSPQKKRLLSTIVIWGGLVAFFTSSTFVPSIPQISRDLNTTGEVVGYAVSVYTFAASVG
GLVGSRYAKFYGRRPVYLCVVGLARHPRNWLEERGTALGTYFGFTFLGIALGPSLGGIIAHYWSWRAIHYLLACF
GCAAFVFLFIFFPETSHPGTRGMDEYARSGKALPKWRPCLLNPFSQLLLLRSPNILAVAISSAVTVITDLALLVP
FAYTIGKRYGIDNEALIGLCFLPLGIGNALGAPLSGRLSDKVVIKYKEMRGYWYPEDRLRAAFFGAFLPFPILAS
ALITKYVSGPIGLTLNLVCLFISGIGCDLVMTPGGAYVVDVLQANSAGATAAVNSFRWMLTSFQTAMLLPMINTY
GHLVTNSVISLLVVFGFMLTALTIAYGKSMRAFVDVGYPTT*
Coding >AgabiH97|064620
ATGACCAACGAGGAATCCCCGTTGCTTCACACCGATGTCTACGACAGGTTTTCACCTCAAAAGAAGAGGTTGTTA
TCCACTATAGTAATATGGGGTGGACTCGTTGCATTTTTTACTTCAAGTACATTCGTGCCATCGATACCTCAAATA
TCCCGAGACCTTAATACGACAGGAGAGGTTGTTGGTTATGCCGTCAGTGTCTATACATTCGCAGCATCCGTCGGG
GGACTTGTAGGATCGAGATACGCCAAATTTTATGGCCGCCGACCGGTGTACCTCTGTGTTGTTGGTCTGGCGAGG
CATCCAAGGAATTGGCTTGAAGAAAGAGGAACGGCTTTGGGTACATACTTTGGCTTTACATTCCTTGGAATCGCC
CTTGGGCCTAGCTTAGGAGGTATAATCGCCCATTATTGGTCGTGGCGTGCAATTCATTATCTTCTGGCTTGCTTT
GGCTGTGCTGCTTTTGTTTTCCTCTTCATTTTCTTCCCCGAAACGAGTCATCCCGGTACAAGAGGTATGGATGAA
TATGCGAGATCAGGAAAAGCTCTTCCGAAATGGAGACCCTGTCTGCTGAATCCATTCTCGCAACTGTTGCTGCTA
CGTAGTCCAAATATTCTCGCTGTGGCTATTAGTAGTGCCGTTACTGTTATAACTGACCTTGCTTTGTTGGTACCA
TTCGCCTATACCATCGGAAAACGCTATGGTATCGACAACGAAGCCCTCATTGGTTTATGCTTCCTCCCTCTTGGT
ATCGGCAATGCACTCGGCGCTCCGCTCTCTGGTCGGCTATCAGATAAGGTAGTCATTAAATATAAAGAAATGCGA
GGGTACTGGTATCCCGAAGACCGCCTGCGTGCTGCCTTTTTTGGCGCGTTTCTACCGTTTCCTATTCTTGCTTCA
GCCCTGATCACAAAATATGTTTCGGGCCCTATCGGACTTACCTTGAATCTCGTATGCTTGTTCATCAGTGGTATT
GGCTGCGACCTCGTCATGACACCGGGTGGGGCATATGTTGTCGATGTCTTGCAAGCGAATAGTGCTGGAGCGACT
GCCGCGGTCAATTCCTTCCGCTGGATGCTTACCTCGTTTCAAACGGCTATGCTTTTGCCTATGATCAATACATAC
GGACACCTGGTCACCAATTCTGTTATTTCACTCTTGGTGGTTTTTGGATTTATGTTAACGGCACTTACAATTGCG
TATGGGAAGTCTATGCGTGCTTTCGTAGACGTTGGTTATCCTACGACATAG
Transcript >AgabiH97|064620
ATGACCAACGAGGAATCCCCGTTGCTTCACACCGATGTCTACGACAGGTTTTCACCTCAAAAGAAGAGGTTGTTA
TCCACTATAGTAATATGGGGTGGACTCGTTGCATTTTTTACTTCAAGTACATTCGTGCCATCGATACCTCAAATA
TCCCGAGACCTTAATACGACAGGAGAGGTTGTTGGTTATGCCGTCAGTGTCTATACATTCGCAGCATCCGTCGGG
GGACTTGTAGGATCGAGATACGCCAAATTTTATGGCCGCCGACCGGTGTACCTCTGTGTTGTTGGTCTGGCGAGG
CATCCAAGGAATTGGCTTGAAGAAAGAGGAACGGCTTTGGGTACATACTTTGGCTTTACATTCCTTGGAATCGCC
CTTGGGCCTAGCTTAGGAGGTATAATCGCCCATTATTGGTCGTGGCGTGCAATTCATTATCTTCTGGCTTGCTTT
GGCTGTGCTGCTTTTGTTTTCCTCTTCATTTTCTTCCCCGAAACGAGTCATCCCGGTACAAGAGGTATGGATGAA
TATGCGAGATCAGGAAAAGCTCTTCCGAAATGGAGACCCTGTCTGCTGAATCCATTCTCGCAACTGTTGCTGCTA
CGTAGTCCAAATATTCTCGCTGTGGCTATTAGTAGTGCCGTTACTGTTATAACTGACCTTGCTTTGTTGGTACCA
TTCGCCTATACCATCGGAAAACGCTATGGTATCGACAACGAAGCCCTCATTGGTTTATGCTTCCTCCCTCTTGGT
ATCGGCAATGCACTCGGCGCTCCGCTCTCTGGTCGGCTATCAGATAAGGTAGTCATTAAATATAAAGAAATGCGA
GGGTACTGGTATCCCGAAGACCGCCTGCGTGCTGCCTTTTTTGGCGCGTTTCTACCGTTTCCTATTCTTGCTTCA
GCCCTGATCACAAAATATGTTTCGGGCCCTATCGGACTTACCTTGAATCTCGTATGCTTGTTCATCAGTGGTATT
GGCTGCGACCTCGTCATGACACCGGGTGGGGCATATGTTGTCGATGTCTTGCAAGCGAATAGTGCTGGAGCGACT
GCCGCGGTCAATTCCTTCCGCTGGATGCTTACCTCGTTTCAAACGGCTATGCTTTTGCCTATGATCAATACATAC
GGACACCTGGTCACCAATTCTGTTATTTCACTCTTGGTGGTTTTTGGATTTATGTTAACGGCACTTACAATTGCG
TATGGGAAGTCTATGCGTGCTTTCGTAGACGTTGGTTATCCTACGACATAG
Gene >AgabiH97|064620
ATGACCAACGAGGAATCCCCGTTGCTTCACACCGATGTCTACGACAGGTTTTCACCTCAAAAGAAGAGGTTGTTA
TCCACTATAGTAATATGGGGTGGACTCGTTGCATGTGATTACTATCTCTTGGTGGTGAACCATGAGGGCTGATTG
ATTGCTATACACAGTTTTTACTTCAAGTACATTCGTGCCATCGATACCTCAAATATCCCGAGACCTTAATACGAC
AGGAGAGGTTGTTGGGTGGGTACCAGGTTACATCCTCCGATTTTACATCTTGCGACTTTTGATATTCACTCTTCC
GTGTTAGTTATGCCGTCAGTGTCTATACATTCGCAGCATCCGTCGGGGGACTTGTAGGATCGAGATACGCCAAAT
TTTGTAAGATTGCCTCTCCTCAAAACTAGCTCCTTTTGGCTCAGTCCAACCAGATGGCCGCCGACCGGTGTACCT
CTGTGGTTTTCCTCTGATGGTCATAGCCTCTCTTGCAGTAGCAAGAGCTAGCACTGTTACCCAGTTGTTGGTCTG
GCGAGGCATCCAAGGAATTGGTGCGGCTCCCAATTACCCACTGGGAGCCGGAGTCATTGGAGACATATACAGGCT
TGAAGAAAGAGGAACGGCTTTGGGTACATACTTTGGCGTGAGTGAAGATTGACTTAGGAGATAATTGTCACTGAT
ACCGTCTATTTTTTCAGTTTACATTCCTTGGAATCGCCCTTGGGCCTAGCTTAGGAGGTATAACCTGCTATTGAC
CCTTATCTGCTCATACGCGATTAATCTGGGATCAGGTATAATCGCCCATTATTGGTCGTGGCGTGCAATTCATTA
TCTTCTGGCTTGCTTTGGCTGTGCTGCTTTTGTTTTCCTCTTCATTTTCTTCCCCGAAACGAGTCATCCCGGTAC
AAGAGGTATGGATGAATATGCGAGATCAGGAAAAGCTCTTCCGAAATGGAGACCCTGTCTGCTGAATCCATTCTC
GCAACTGTTGCTGCTACGTAGTCCAAATATTCTCGCTGTGGTGCGTTGTGCCTTGATCTTATAAATTATCACTCC
CTGAAAAAGCTACGTTGAGCCCCCTAGGCTATTAGTAGTGCCGTTACTGTTATAACTGACCTTGGTGAGTAAGTT
CATAACATCCTACGTGTATTCTGACTCGTTGAAATCAACAGCTTTGTTGGTACCATTCGCCTATACCATCGTGCG
TAGGTTACTTCGTCACTCGTTCGGCTATAACTCAAAATCCAGGTTTTAGGGAAAACGCTATGGTATCGACAACGA
AGCCCTCATTGGTTTATGCTTCCTCCCTCTTGGTATCGGCAATGCACGTAAGAAGAAACATAAGTCTCCCCTTTT
ACATGACCTCCACTAATGTTCTGTTTCCTCTTCAGTCGGCGCTCCGCTCTCTGGTCGGCTATCAGATAAGGTAGT
CATTAAATATAAAGAAATGCGAGGGTACTGGTATCCCGAAGACCGCCTGCGTGCTGCCTTTTTTGGCGCGTTTCT
ACCGTTTCCTATTCTTGCTTCAGCCCTGATCACAAAATATGTTTCGGGCCCTATCGGACTTACCTTGAATCTCGT
ATGCTTGTTCATCAGTGGTATTGGCGTAAGTCTATCCTTTCTTATCTTTCTTCCCCACGACGAATGATATTTTTT
GACCTTGCTAGTGCGACCTCGTCATGACACCGGGTGGGGCATATGTTGTCGATGTCTTGCAAGCGAATAGTGCTG
GAGCGACTGCCGCGGTCAAGTACGTCTCGGCTTCATCACGAGTCTGCTTCATCTCATAAACTTCTTTTAGTTCCT
TCCGCTGGATGCTTACCTCGTTTCAAACGGCTATGCTTTTGCCTATGATCAATACATACGGACACCTGGTCACCA
ATTCTGTTATTTCACTCTTGGTGGTTTTTGGATTTATGTAGGATATTTTCAGATTTTGACTATATTCAACTTTAC
TCATTTCTGATGTGTTGAATAGGTTAACGGCACTTACAATTGCGTATGGGAAGTCTATGCGTGCTTTCGTAGACG
TTGGTTATCCTACGACATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail