Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|063710
Gene name
Locationscaffold_3:2648189..2651630
Strand-
Gene length (bp)3441
Transcript length (bp)2376
Coding sequence length (bp)2376
Protein length (aa) 792

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain 3.7E-21 87 235
PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase 1.2E-07 336 502

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M8Z7|U80A2_ARATH Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana GN=UGT80A2 PE=1 SV=1 74 514 1.0E-127
sp|Q9XIG1|U80B1_ARATH Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana GN=UGT80B1 PE=2 SV=1 13 514 6.0E-125
sp|Q6C8M8|ATG26_YARLI Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG26 PE=3 SV=3 85 513 6.0E-85
sp|Q6BN88|ATG26_DEBHA Sterol 3-beta-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG26 PE=3 SV=2 80 513 2.0E-84
sp|Q2U0C3|ATG26_ASPOR Sterol 3-beta-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg26 PE=3 SV=2 66 513 8.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M8Z7|U80A2_ARATH Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana GN=UGT80A2 PE=1 SV=1 74 514 1.0E-127
sp|Q9XIG1|U80B1_ARATH Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana GN=UGT80B1 PE=2 SV=1 13 514 6.0E-125
sp|Q6C8M8|ATG26_YARLI Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG26 PE=3 SV=3 85 513 6.0E-85
sp|Q6BN88|ATG26_DEBHA Sterol 3-beta-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG26 PE=3 SV=2 80 513 2.0E-84
sp|Q2U0C3|ATG26_ASPOR Sterol 3-beta-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg26 PE=3 SV=2 66 513 8.0E-83
sp|Q0CKU4|ATG26_ASPTN Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg26 PE=3 SV=1 14 513 8.0E-83
sp|A2QNQ5|ATG26_ASPNC Sterol 3-beta-glucosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg26 PE=3 SV=2 25 513 1.0E-82
sp|A1CFB3|ATG26_ASPCL Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg26 PE=3 SV=1 66 513 9.0E-82
sp|P0CN91|ATG26_CRYNB Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG26 PE=3 SV=1 85 513 1.0E-81
sp|P0CN90|ATG26_CRYNJ Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG26 PE=3 SV=1 85 513 1.0E-81
sp|Q9Y751|ATG26_PICPG Sterol 3-beta-glucosyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ATG26 PE=3 SV=1 19 513 5.0E-81
sp|Q8NJS1|ATG26_LEPMC Sterol 3-beta-glucosyltransferase OS=Leptosphaeria maculans GN=ATG26 PE=3 SV=1 71 513 6.0E-81
sp|Q5A950|ATG26_CANAL Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG26 PE=3 SV=1 80 513 1.0E-80
sp|A7A179|ATG26_YEAS7 Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG26 PE=3 SV=1 89 513 1.0E-80
sp|Q0UY53|ATG26_PHANO Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG26 PE=3 SV=1 71 513 3.0E-80
sp|Q06321|ATG26_YEAST Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG26 PE=1 SV=1 89 513 4.0E-80
sp|A1CYS1|ATG26_NEOFI Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg26 PE=3 SV=1 66 513 8.0E-80
sp|A7TF84|ATG26_VANPO Sterol 3-beta-glucosyltransferase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG26 PE=3 SV=1 89 513 2.0E-79
sp|A7KAN4|ATG26_PENRW Sterol 3-beta-glucosyltransferase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg26 PE=3 SV=1 66 513 4.0E-79
sp|Q5B4C9|ATG26_EMENI Sterol 3-beta-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg26 PE=3 SV=1 29 534 1.0E-78
sp|Q4WID6|ATG26_ASPFU Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg26 PE=3 SV=2 66 513 2.0E-78
sp|Q7S1I0|ATG26_NEUCR Sterol 3-beta-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-12 PE=3 SV=1 51 513 2.0E-77
sp|Q751Z4|ATG26_ASHGO Sterol 3-beta-glucosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG26 PE=3 SV=2 89 513 4.0E-77
sp|Q54IL5|UGT52_DICDI UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum GN=ugt52 PE=2 SV=1 85 515 5.0E-76
sp|Q6CUV2|ATG26_KLULA Sterol 3-beta-glucosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG26 PE=3 SV=1 89 513 3.0E-75
sp|A7ERM5|ATG26_SCLS1 Sterol 3-beta-glucosyltransferase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg26 PE=3 SV=1 77 513 5.0E-74
sp|A7KAK6|ATG26_PICAN Sterol 3-beta-glucosyltransferase OS=Pichia angusta GN=ATG26 PE=3 SV=1 34 513 6.0E-73
sp|O70023|TYLN_STRFR O-mycaminosyltylonolide 6-deoxyallosyltransferase OS=Streptomyces fradiae GN=tylN PE=1 SV=2 85 504 4.0E-38
sp|P9WLV0|Y1526_MYCTO Uncharacterized protein MT1577 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1577 PE=4 SV=1 85 496 2.0E-20
sp|P9WLV1|Y1526_MYCTU Uncharacterized protein Rv1526c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1526c PE=4 SV=1 85 496 2.0E-20
sp|P64870|Y1553_MYCBO Uncharacterized protein Mb1553c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1553c PE=4 SV=1 85 496 2.0E-20
sp|P96559|GTFB_AMYOR Vancomycin aglycone glucosyltransferase OS=Amycolatopsis orientalis GN=gtfB PE=1 SV=1 85 500 9.0E-19
sp|Q9AFC6|GTFE_AMYOR Glycosyltransferase GtfE OS=Amycolatopsis orientalis GN=gtfE PE=3 SV=1 85 500 1.0E-18
sp|P96560|GTFC_AMYOR Glycosyltransferase GtfC OS=Amycolatopsis orientalis GN=gtfC PE=1 SV=1 85 500 7.0E-18
sp|Q9AFC7|GTFD_AMYOR Desvancosaminyl-vancomycin vancosaminetransferase OS=Amycolatopsis orientalis GN=gtfD PE=1 SV=1 85 500 6.0E-17
sp|Q49929|Y2348_MYCLE Uncharacterized glycosyltransferase ML2348 OS=Mycobacterium leprae (strain TN) GN=ML2348 PE=3 SV=1 314 496 2.0E-16
sp|P96558|GTFA_AMYOR dTDP-epi-vancosaminyltransferase OS=Amycolatopsis orientalis GN=gtfA PE=1 SV=1 85 515 5.0E-14
sp|P64866|Y1551_MYCBO Uncharacterized glycosyltransferase Mb1551 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1551 PE=3 SV=1 314 459 1.0E-13
sp|P9WN07|Y1524_MYCTU Uncharacterized glycosyltransferase Rv1524 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1524 PE=1 SV=1 314 459 1.0E-13
sp|P9WN06|Y1524_MYCTO Uncharacterized glycosyltransferase MT1575 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1575 PE=3 SV=1 314 459 1.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0030259 lipid glycosylation Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016758 hexosyltransferase activity Yes
GO:0008194 UDP-glycosyltransferase activity Yes
GO:0030258 lipid modification No
GO:0044238 primary metabolic process No
GO:0016757 glycosyltransferase activity No
GO:0070085 glycosylation No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0044255 cellular lipid metabolic process No
GO:0044237 cellular metabolic process No
GO:0006629 lipid metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|063710
MADQDQGNQEPSGSTTAHNHLGAALGQAKEISQNNSLPTSVQLHSDGRINVSLALNRGLPDLPRNHALHVDEFAI
DLNWRDCPCMSIVIMVVGSRGDVQPYVALGKRLKQDGHRIRIATHDAFRQFVIDEGLEFFDIGGNPVDLMSYMVR
NPGMIPGMLTLTNGDLKKKKAMLKEIIYGCWKSCYAPSRGRKGPFVVDAIISNPPGFAHVHCAEALGIPLQMSFT
MPWCPTTAFPHPLVNITNSDAKTGLTNYLTYYMADLLTWKGLGSHINKLRKRVLNLEALDVRTGPSILEDLKIPW
TYCMSPALVPSPEDWQNHIDVVGFYFLNLATKYEPSSDLVAFLNAGDTPIYIGFGSIVVDNPHALTKLIFEATAH
AGVRALVSAGWGGLGGIDIPPHIFILESIPHDWLFDNERVSAVVHHGGAGTTAIGLAKGRPTVVVPFFGDQRFWG
RMVRRTGAGPKPIPHKKLTVAKLSDAIKYALSPTAKEAARKVARQIHDDNGIEKGVQSFYQHLPLLNMRCDLCPT
RLAVWWSTKHCLKLSALAAQTLERAGLIEMRELELHRTKEYEVDQGFSLSGEVGSAFESVSAAAEKLFSPVKNVF
RTTSVPRGILNMTSSFPESPIAESDSNSIADDHKKQEVPKTRNSWSNRLSLGLFHRDHEPSHEERERRRRFSFPV
LKNARPFRSAKKRTHTRHARHLHVLGVRPLSKVEEQRRRERLREGRKAYTASTDHERNQIVEAFRRAKGELPARR
NTYIDAAKVVLASRQGRGHQSLMIDTRYQGTAAGAGGVETN*
Coding >AgabiH97|063710
ATGGCAGATCAGGATCAGGGCAACCAGGAGCCCAGTGGCTCTACCACAGCTCATAACCATCTCGGGGCAGCTTTG
GGGCAAGCGAAAGAAATTAGCCAAAACAACAGTCTACCAACCAGCGTTCAGCTTCATTCCGATGGCCGTATCAAT
GTTTCCCTTGCTTTAAATCGTGGACTCCCTGATCTCCCGCGCAATCACGCACTACATGTCGACGAATTTGCTATC
GATTTGAATTGGAGGGACTGTCCTTGCATGAGCATTGTTATAATGGTTGTTGGGAGTCGAGGTGACGTACAACCA
TATGTTGCATTAGGAAAACGATTGAAGCAAGATGGTCATCGGATTCGTATCGCCACGCACGACGCATTCCGCCAA
TTCGTGATCGACGAGGGCCTCGAATTCTTCGATATAGGAGGCAACCCTGTCGATCTCATGAGTTACATGGTCAGG
AATCCTGGCATGATACCCGGGATGCTGACGTTAACTAACGGCGATCTCAAGAAGAAGAAAGCTATGTTGAAAGAG
ATAATTTACGGATGTTGGAAGTCATGTTATGCACCCTCTCGAGGCAGGAAAGGCCCTTTTGTCGTCGATGCTATC
ATTTCGAATCCTCCAGGTTTCGCGCACGTCCATTGCGCAGAAGCGCTTGGGATCCCTCTTCAAATGAGTTTTACC
ATGCCCTGGTGTCCAACGACGGCGTTTCCACACCCGCTGGTCAACATCACAAATAGCGACGCTAAAACAGGACTT
ACTAATTATTTAACTTACTACATGGCTGATTTATTGACCTGGAAAGGGCTCGGAAGCCATATCAACAAACTCAGA
AAACGTGTTCTTAATTTGGAAGCTCTCGATGTTCGTACAGGACCCAGTATTCTAGAAGATCTCAAAATACCCTGG
ACATATTGTATGAGCCCCGCACTGGTACCAAGTCCCGAGGACTGGCAGAATCATATCGACGTGGTCGGCTTCTAC
TTTCTGAATCTCGCTACCAAATATGAACCGTCGTCAGACCTTGTTGCATTTTTGAATGCGGGAGATACCCCTATC
TATATTGGATTCGGCTCTATCGTTGTCGATAATCCTCATGCTCTCACGAAACTTATATTTGAAGCGACAGCACAT
GCAGGAGTACGAGCGCTTGTGTCTGCAGGATGGGGTGGGCTGGGTGGCATTGATATTCCTCCACATATCTTCATT
CTGGAAAGTATACCACATGATTGGCTGTTTGACAATGAGCGCGTTTCCGCTGTGGTGCATCATGGCGGTGCAGGG
ACTACTGCTATTGGCTTGGCGAAAGGTCGACCTACAGTCGTCGTGCCCTTCTTTGGCGATCAGCGATTTTGGGGT
AGGATGGTTCGTCGAACTGGAGCCGGGCCTAAACCTATCCCGCATAAAAAGTTGACGGTTGCTAAATTGAGCGAC
GCGATCAAGTATGCTCTCAGTCCTACGGCGAAAGAAGCTGCGCGAAAAGTAGCACGTCAAATTCACGATGATAAC
GGTATTGAAAAGGGCGTGCAAAGCTTTTATCAGCACCTTCCACTTTTGAACATGCGATGTGATCTTTGTCCAACT
CGCCTTGCCGTTTGGTGGTCTACTAAACATTGCCTTAAGTTAAGCGCACTGGCTGCGCAAACTCTAGAGAGAGCT
GGCCTTATTGAGATGCGTGAACTTGAGCTTCACCGGACAAAGGAATATGAAGTAGATCAAGGATTTTCATTATCT
GGCGAAGTTGGATCTGCTTTTGAATCCGTATCGGCGGCGGCAGAGAAACTTTTTTCTCCGGTAAAAAATGTTTTC
AGGACTACTTCAGTACCACGAGGAATTTTGAATATGACATCTTCTTTCCCGGAATCACCAATTGCGGAGTCGGAC
AGTAACTCAATTGCGGATGATCATAAGAAGCAAGAGGTACCGAAGACGCGGAATAGCTGGTCAAATCGTTTATCT
CTAGGTCTATTCCATCGAGACCACGAACCATCACATGAAGAAAGGGAAAGGAGGCGTCGGTTTTCTTTTCCTGTC
TTGAAGAACGCGCGCCCGTTTCGTTCTGCGAAAAAGAGAACCCACACCAGACATGCTCGACATCTACACGTATTA
GGAGTTCGGCCTTTGTCAAAGGTAGAAGAGCAACGTCGTAGAGAGCGTTTGAGGGAAGGAAGAAAAGCGTATACC
GCTAGTACGGATCATGAACGCAACCAGATTGTCGAGGCATTCCGGCGTGCTAAGGGTGAATTGCCAGCGAGAAGA
AATACTTACATCGATGCCGCGAAAGTGGTCCTTGCAAGCAGGCAGGGCCGGGGACATCAATCCCTGATGATAGAC
ACTCGATATCAAGGGACTGCTGCAGGAGCGGGAGGTGTAGAAACGAATTAG
Transcript >AgabiH97|063710
ATGGCAGATCAGGATCAGGGCAACCAGGAGCCCAGTGGCTCTACCACAGCTCATAACCATCTCGGGGCAGCTTTG
GGGCAAGCGAAAGAAATTAGCCAAAACAACAGTCTACCAACCAGCGTTCAGCTTCATTCCGATGGCCGTATCAAT
GTTTCCCTTGCTTTAAATCGTGGACTCCCTGATCTCCCGCGCAATCACGCACTACATGTCGACGAATTTGCTATC
GATTTGAATTGGAGGGACTGTCCTTGCATGAGCATTGTTATAATGGTTGTTGGGAGTCGAGGTGACGTACAACCA
TATGTTGCATTAGGAAAACGATTGAAGCAAGATGGTCATCGGATTCGTATCGCCACGCACGACGCATTCCGCCAA
TTCGTGATCGACGAGGGCCTCGAATTCTTCGATATAGGAGGCAACCCTGTCGATCTCATGAGTTACATGGTCAGG
AATCCTGGCATGATACCCGGGATGCTGACGTTAACTAACGGCGATCTCAAGAAGAAGAAAGCTATGTTGAAAGAG
ATAATTTACGGATGTTGGAAGTCATGTTATGCACCCTCTCGAGGCAGGAAAGGCCCTTTTGTCGTCGATGCTATC
ATTTCGAATCCTCCAGGTTTCGCGCACGTCCATTGCGCAGAAGCGCTTGGGATCCCTCTTCAAATGAGTTTTACC
ATGCCCTGGTGTCCAACGACGGCGTTTCCACACCCGCTGGTCAACATCACAAATAGCGACGCTAAAACAGGACTT
ACTAATTATTTAACTTACTACATGGCTGATTTATTGACCTGGAAAGGGCTCGGAAGCCATATCAACAAACTCAGA
AAACGTGTTCTTAATTTGGAAGCTCTCGATGTTCGTACAGGACCCAGTATTCTAGAAGATCTCAAAATACCCTGG
ACATATTGTATGAGCCCCGCACTGGTACCAAGTCCCGAGGACTGGCAGAATCATATCGACGTGGTCGGCTTCTAC
TTTCTGAATCTCGCTACCAAATATGAACCGTCGTCAGACCTTGTTGCATTTTTGAATGCGGGAGATACCCCTATC
TATATTGGATTCGGCTCTATCGTTGTCGATAATCCTCATGCTCTCACGAAACTTATATTTGAAGCGACAGCACAT
GCAGGAGTACGAGCGCTTGTGTCTGCAGGATGGGGTGGGCTGGGTGGCATTGATATTCCTCCACATATCTTCATT
CTGGAAAGTATACCACATGATTGGCTGTTTGACAATGAGCGCGTTTCCGCTGTGGTGCATCATGGCGGTGCAGGG
ACTACTGCTATTGGCTTGGCGAAAGGTCGACCTACAGTCGTCGTGCCCTTCTTTGGCGATCAGCGATTTTGGGGT
AGGATGGTTCGTCGAACTGGAGCCGGGCCTAAACCTATCCCGCATAAAAAGTTGACGGTTGCTAAATTGAGCGAC
GCGATCAAGTATGCTCTCAGTCCTACGGCGAAAGAAGCTGCGCGAAAAGTAGCACGTCAAATTCACGATGATAAC
GGTATTGAAAAGGGCGTGCAAAGCTTTTATCAGCACCTTCCACTTTTGAACATGCGATGTGATCTTTGTCCAACT
CGCCTTGCCGTTTGGTGGTCTACTAAACATTGCCTTAAGTTAAGCGCACTGGCTGCGCAAACTCTAGAGAGAGCT
GGCCTTATTGAGATGCGTGAACTTGAGCTTCACCGGACAAAGGAATATGAAGTAGATCAAGGATTTTCATTATCT
GGCGAAGTTGGATCTGCTTTTGAATCCGTATCGGCGGCGGCAGAGAAACTTTTTTCTCCGGTAAAAAATGTTTTC
AGGACTACTTCAGTACCACGAGGAATTTTGAATATGACATCTTCTTTCCCGGAATCACCAATTGCGGAGTCGGAC
AGTAACTCAATTGCGGATGATCATAAGAAGCAAGAGGTACCGAAGACGCGGAATAGCTGGTCAAATCGTTTATCT
CTAGGTCTATTCCATCGAGACCACGAACCATCACATGAAGAAAGGGAAAGGAGGCGTCGGTTTTCTTTTCCTGTC
TTGAAGAACGCGCGCCCGTTTCGTTCTGCGAAAAAGAGAACCCACACCAGACATGCTCGACATCTACACGTATTA
GGAGTTCGGCCTTTGTCAAAGGTAGAAGAGCAACGTCGTAGAGAGCGTTTGAGGGAAGGAAGAAAAGCGTATACC
GCTAGTACGGATCATGAACGCAACCAGATTGTCGAGGCATTCCGGCGTGCTAAGGGTGAATTGCCAGCGAGAAGA
AATACTTACATCGATGCCGCGAAAGTGGTCCTTGCAAGCAGGCAGGGCCGGGGACATCAATCCCTGATGATAGAC
ACTCGATATCAAGGGACTGCTGCAGGAGCGGGAGGTGTAGAAACGAATTAG
Gene >AgabiH97|063710
ATGGCAGATCAGGATCAGGGCAACCAGGAGCCCAGTGGCTCTACCACAGCTCATAACCATCTCGGGGCAGCTTTG
GGTAAGTTAATACCCACCCGGGATAGCCATGGCGAAAACTAAACTTCGATCACCCCTTTCATGTTTTAGGGCAAG
CGAAAGAAATTAGCCAAAACAACAGTCTACCAACCAGCGTTCAGCTTCATTCCGATGGCCGTATCAATGTTTCCC
TTGCTTTAAATCGTGGACTCCCTGATCTCCCGCGCAATCACGCACTACATGTCGACGAATTTGCTATCGATTTGA
ATTGGAGGGACTGTCCTTGCATGAGCATTGTTATAATGGTTGTTGGGAGTCGAGGTGCGTTTCCTAGTCACTGCA
GGAGGTTTTCCGGAAGGCTCACTGAACGTGTAGGTGACGTACAACCATATGTTGCATTAGGAAAACGATTGAAGC
AAGATGGTCATCGGATTCGTATCGCCACGCACGACGCATTCCGCCAATTCGTGATCGACGAGGGCCTCGAATTCT
TCGATATAGGAGGCAACCCTGTCGATCTCATGAGTTACATGGTCAGGAGTAAGGAGTTTTTTCAATGTCGTTTGT
GCGCAGCTCTCATTCGAGTTTTGAGATCCTGGCATGATACCCGGGATGCTGACGTTAACTAACGGCGATCTCAAG
AAGAAGAAAGCTATGTTGAAAGAGGTATGTCCGTTACCTTCCTTTCCATTTATGTCTTTGACTTTCGAGGTGTAG
ATAATTTACGGATGTTGGAAGTCATGTTATGCACCCTCTCGAGGCAGGAAAGGCCCTTTTGTCGTCGATGCTATC
ATTTCGAATCCTCCAGGTTTCGCGCACGTCCATTGCGCAGAAGCGCTTGGGATCCCTCTTCAAATGAGTTTTAGT
AGGTACTTTCATATATCTTTGGGTAAAGTTGACGCATTGAGCTATTACTCCTGTTAGCCATGCCCTGGTCAGTGT
ACCTTCTCTTCCTTCTCAATTATTGTATTGAAGGATTTCTAGGTGTCCAACGACGGCGTTTCCACACCCGCTGGT
CAACATCACAAATAGCGACGCTAAAACAGGACTTACTAATTATTTAACTTACTACATGGCTGATTTATTGACCTG
GAAAGGGTGCGGTCGTCTCGTCCACATTGCACATATGAACAGACTTATTGATGGGCGTTATTAGGCTCGGAAGCC
ATATCAACAAACTCAGAAAACGTGTTCTTAATTTGGAAGCTCTCGATGTTCGTACAGGACCCAGTATTCTAGAAG
ATCTCAAAATACCCTGGACATATTGTATGAGCCCCGCACTGGTACCAAGTCCCGAGGACTGGCAGAATCATATCG
GTAATATCAAATTTAGTCTGTGATCCAATTAGGCTAAAATAGATTTAGACGTGGTCGGCTTCTACTTTCTGAATC
TCGCTACCAAATATGAACCGTCGTCAGACCTTGTTGCATTTTTGAATGCGGGAGATACCCCTATCTATATTGGGT
ACTTGTTCGACAATCGTTCTTTCATACGTGTCGGTCTGACGAATTGATAGATTCGGCTCTATCGTTGTCGATAAT
CCTCATGCTCTCACGAGTAAATCAGATCTATTCACTTTCTCAGAAAATCATTGATCCGGCTTTGGGTAGAACTTA
TATTTGAAGCGACAGCACATGCAGGAGTACGAGCGCTTGTGTCTGCAGGATGGGTAAGGCAGTCATATTCTATCG
TCAGCCCAGAATCAATTAAACTCAAATCATAGGGTGGGCTGGGTGGCATTGATATTCCTCCACATATCTTCATTC
TGGAAAGTATACCACATGATTGGCTGTTTGACAATGAGCGCGTTTCCGCTGTGGTGCATCATGGCGGTGCAGGGA
CTACTGCTATTGGCTTGGCGAAAGGTCGACCTACAGTCGTCGTGCCCTTCTTTGGCGATCAGCGATTTTGGGGTA
CGTCATTATCTATTCTCATTATTGCCCCCTCACCAAAAAGCATTTCAAATAGGTAGGATGGTTCGTCGAACTGGA
GCCGGGCCTAAACCTATCCCGCATAAAAAGTTGACGGTTGCTAAATTGAGCGACGCGATCAAGTATGCTCTCAGT
CCTACGGCGAAAGAAGCTGCGCGAAAAGTAGCACGTCAAATTCACGATGATGTAAGTTTTCCCTCCTGTCTTGAA
GGTCTTGTGCTAACCACCGTTGCGTGTTTAGAACGGTATTGAAAAGGGCGTGCAAAGCTTTTATCAGCACCTTCC
ACTTTTGAACATGCGATGTGATCTTTGTCCAACTCGCCTTGCCGTTTGGTGGTCTACTAAACATGTAAGATTCAG
ATATCGTCTACACCAGGAAAGCTAATTACAATCGTACATAGTGCCTTAAGTTAAGCGCACTGGCTGCGCAAACTC
TAGAGAGAGCTGGCCTTATTGAGATGCGTGAACTTGAGCTTCACCGTAGGTGTTTTTCTTTCCAGGAAACGAAAC
CCTCTCATTTCATGGAATTGGGGAATAGGGACAAAGGAATATGAAGTAGATCAAGGATTTTCATTATCTGGCGAA
GTTGGATCTGCTTTTGAATCCGTATCGGCGGCGGCAGAGAAACTTTTGTATGTCCTATTTTCACCTCAATTGCAG
TGCGTCTTACTATATATTGTCAGTTCTCCGGTAAAAAATGTTTTCAGGACTACTTCAGTACCACGAGGTAATTCC
AAGTTTTTGTTAGGTGTCAGTCAAGTGAACGATTCACACCCCTTGGAAGGAATTTTGAATATGACATCTTCTTTC
CCGGAATCACCAATTGCGGAGTCGGACAGTAACTCAATTGCGGATGATCATAAGAAGCAAGAGGTACCGAAGACG
CGGAATAGCTGGTCAAATGTAAAATTTCTTTCTCACTTTTTTCTTTGCTAGCTCACATCCAGCCCGTTTCTCTTT
CCTCGGGAATTCTTTAGCGTTTATCTCTAGGTCTATTCCATCGAGACCACGAACCATCACATGAAGAAAGGGAAA
GGAGGCGTCGGTTTTCTTTTCCTGTCTTGAAGAACGCGCGCCCGTTTCGTTCTGCGAAAAAGAGAACCCACACCA
GACATGCTCGACATCGTGAGTCTTAATAAAGTATATATACATGTATGCTTAGCGCAAAAGCTGAAGTTCATATAT
ATAGTACACGTATTAGGAGTTCGGCCTTTGTCAAAGGTAGAAGAGCAACGTCGTAGAGAGCGTTTGAGGGAAGGA
AGAAAAGCGTATACCGCTAGTACGGATCATGAACGCAACCAGATTGTCGAGGCATTCCGGCGTGCTAAGGGTGAA
TTGCCAGCGAGAAGAAATACTTACATCGATGCCGCGAAAGTGGTCCTTGCAAGCAGGCAGGGCCGGGGACATCAA
TCCCTGATGATAGACACTCGATATCAAGGGACTGCTGCAGGAGCGGGAGGTGTAGAAACGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail