Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|063560
Gene name
Locationscaffold_3:2619479..2620430
Strand+
Gene length (bp)951
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02585 PIG-L GlcNAc-PI de-N-acetylase 2.5E-21 36 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDW9|GPI12_SCHPO Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi12 PE=3 SV=1 35 273 3.0E-34
sp|Q5SX19|PIGL_MOUSE N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Mus musculus GN=Pigl PE=2 SV=1 34 276 4.0E-34
sp|O35790|PIGL_RAT N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Rattus norvegicus GN=Pigl PE=2 SV=1 34 279 7.0E-34
sp|Q54C64|PIGL_DICDI Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Dictyostelium discoideum GN=pigl PE=3 SV=1 33 282 1.0E-33
sp|A6QQ24|PIGL_BOVIN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Bos taurus GN=PIGL PE=2 SV=1 31 276 4.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDW9|GPI12_SCHPO Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi12 PE=3 SV=1 35 273 3.0E-34
sp|Q5SX19|PIGL_MOUSE N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Mus musculus GN=Pigl PE=2 SV=1 34 276 4.0E-34
sp|O35790|PIGL_RAT N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Rattus norvegicus GN=Pigl PE=2 SV=1 34 279 7.0E-34
sp|Q54C64|PIGL_DICDI Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Dictyostelium discoideum GN=pigl PE=3 SV=1 33 282 1.0E-33
sp|A6QQ24|PIGL_BOVIN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Bos taurus GN=PIGL PE=2 SV=1 31 276 4.0E-33
sp|Q9Y2B2|PIGL_HUMAN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Homo sapiens GN=PIGL PE=1 SV=1 24 276 2.0E-32
sp|D4B4K9|GPI12_ARTBC N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03399 PE=3 SV=1 24 280 2.0E-30
sp|P23797|GPI12_YEAST N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI12 PE=1 SV=2 4 278 2.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 5 24 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|063560
MGSTFIVIVFSILILLLTLPYDTGRFTASDGHRRILFLTAHPDDECLFFAPTILGLNRTETNLYALSLSIGNADG
LGAVRREEYHRSYDVLGIPHEQRWIVDHPKLQDNFTSSWDPKVISKEINHYILSNEIDTILTFDSAGISSHPNHI
SLPYGVAHLIQHLDSLDRPTPRLYTLTTVPLFAKYTSILAPLLAKFDVVLARVVDRLINLTGNKSALSSILPVRI
SDPPSKARAVPMFVSGIPEYVRALKAMRMHESQLVWFRWLYVSFSRYMWVNDWQEVKVQ*
Coding >AgabiH97|063560
ATGGGATCGACGTTCATCGTCATTGTGTTTTCCATCCTCATCCTCCTCCTGACCTTGCCGTATGACACCGGGAGA
TTTACTGCTAGCGATGGCCACAGGCGTATCTTGTTCTTGACCGCACATCCAGACGACGAATGTCTTTTTTTTGCC
CCTACGATACTTGGACTCAACCGTACAGAAACCAACCTTTACGCGCTCAGTCTTTCAATAGGCAATGCAGATGGT
CTTGGGGCAGTGAGAAGAGAAGAGTATCACAGAAGCTATGATGTCCTCGGTATTCCCCATGAGCAGCGCTGGATA
GTTGATCATCCGAAGCTACAAGATAACTTCACTTCGAGTTGGGATCCCAAGGTCATAAGCAAAGAGATCAATCAT
TACATTCTCAGTAATGAGATTGATACGATCTTAACATTCGATTCGGCTGGCATATCCTCTCACCCCAACCACATC
TCACTTCCTTATGGCGTCGCACATCTTATCCAACATCTCGACTCCCTCGACCGCCCAACGCCGCGTCTTTATACC
CTCACAACGGTCCCGTTGTTTGCCAAGTACACGTCCATCCTAGCACCACTCCTCGCCAAATTTGATGTTGTGCTG
GCGCGAGTCGTCGACCGCTTGATCAACCTTACGGGAAATAAATCTGCCCTGTCCAGCATTTTGCCAGTGAGGATC
AGCGATCCGCCTTCCAAAGCTAGGGCTGTGCCGATGTTCGTTTCTGGAATTCCTGAATATGTGCGCGCGTTGAAG
GCGATGCGGATGCATGAAAGCCAACTCGTATGGTTCCGATGGCTTTATGTGTCGTTTTCGCGGTACATGTGGGTA
AATGATTGGCAGGAGGTCAAAGTACAGTGA
Transcript >AgabiH97|063560
ATGGGATCGACGTTCATCGTCATTGTGTTTTCCATCCTCATCCTCCTCCTGACCTTGCCGTATGACACCGGGAGA
TTTACTGCTAGCGATGGCCACAGGCGTATCTTGTTCTTGACCGCACATCCAGACGACGAATGTCTTTTTTTTGCC
CCTACGATACTTGGACTCAACCGTACAGAAACCAACCTTTACGCGCTCAGTCTTTCAATAGGCAATGCAGATGGT
CTTGGGGCAGTGAGAAGAGAAGAGTATCACAGAAGCTATGATGTCCTCGGTATTCCCCATGAGCAGCGCTGGATA
GTTGATCATCCGAAGCTACAAGATAACTTCACTTCGAGTTGGGATCCCAAGGTCATAAGCAAAGAGATCAATCAT
TACATTCTCAGTAATGAGATTGATACGATCTTAACATTCGATTCGGCTGGCATATCCTCTCACCCCAACCACATC
TCACTTCCTTATGGCGTCGCACATCTTATCCAACATCTCGACTCCCTCGACCGCCCAACGCCGCGTCTTTATACC
CTCACAACGGTCCCGTTGTTTGCCAAGTACACGTCCATCCTAGCACCACTCCTCGCCAAATTTGATGTTGTGCTG
GCGCGAGTCGTCGACCGCTTGATCAACCTTACGGGAAATAAATCTGCCCTGTCCAGCATTTTGCCAGTGAGGATC
AGCGATCCGCCTTCCAAAGCTAGGGCTGTGCCGATGTTCGTTTCTGGAATTCCTGAATATGTGCGCGCGTTGAAG
GCGATGCGGATGCATGAAAGCCAACTCGTATGGTTCCGATGGCTTTATGTGTCGTTTTCGCGGTACATGTGGGTA
AATGATTGGCAGGAGGTCAAAGTACAGTGA
Gene >AgabiH97|063560
ATGGGATCGACGTTCATCGTCATTGTGTTTTCCATCCTCATCCTCCTCCTGACCTTGCCGTATGACACCGGGAGA
TTTACTGCTAGCGATGGCCACAGGCGTATCTTGTTCTTGACCGCACATCCAGACGACGAATGTCTTTTTTTTGCC
CCTACGATACTTGGACTCAACCGTACAGAAACCAACCTTTACGCGCTCAGTCTTTCAATAGGCAATGCAGATGGT
CTTGGGGCAGTGAGAAGAGAAGAGTATCACAGAAGCTATGATGTCCTCGGTATTCCCCATGAGCAGCGCTGGATA
GTTGATCATCCGTGGGTAGTCTTCTTTGAGCTCCGGCTCCAACTTGATGGAATGTTATAGGAAGCTACAAGATAA
CTTCACTTCGAGTTGGGATCCCAAGGTCATAAGCAAAGAGATCAATCATTACATTCTCAGTAATGAGATTGATAC
GGTATCTCTTCTTTCCCGTTTGTCTTGCACGATCTAAGCCATTGCCAGATCTTAACATTCGATTCGGCTGGCATA
TCCTCTCACCCCAACCACATCTCACTTCCTTATGGCGTCGCACATCTTATCCAACATCTCGACTCCCTCGACCGC
CCAACGCCGCGTCTTTATACCCTCACAACGGTCCCGTTGTTTGCCAAGTACACGTCCATCCTAGCACCACTCCTC
GCCAAATTTGATGTTGTGCTGGCGCGAGTCGTCGACCGCTTGATCAACCTTACGGGAAATAAATCTGCCCTGTCC
AGCATTTTGCCAGTGAGGATCAGCGATCCGCCTTCCAAAGCTAGGGCTGTGCCGATGTTCGTTTCTGGAATTCCT
GAATATGTGCGCGCGTTGAAGGCGATGCGGATGCATGAAAGCCAACTCGTATGGTTCCGATGGCTTTATGTGTCG
TTTTCGCGGTACATGTGGGTAAATGATTGGCAGGAGGTCAAAGTACAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail