Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|063500
Gene name
Locationscaffold_3:2602612..2606128
Strand-
Gene length (bp)3516
Transcript length (bp)2565
Coding sequence length (bp)2565
Protein length (aa) 855

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00580 UvrD-helicase UvrD/REP helicase N-terminal domain 6.2E-63 21 294
PF13361 UvrD_C UvrD-like helicase C-terminal domain 2.1E-60 300 648
PF13245 AAA_19 AAA domain 5.2E-31 25 278
PF13538 UvrD_C_2 UvrD-like helicase C-terminal domain 2.2E-12 592 646

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9S3Q0|PCRA_LEUCI ATP-dependent DNA helicase PcrA OS=Leuconostoc citreum GN=pcrA PE=3 SV=1 19 685 9.0E-126
sp|Q10213|SRS2_SCHPO ATP-dependent DNA helicase srs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srs2 PE=1 SV=1 15 647 2.0E-121
sp|Q9CD72|UVRD1_MYCLE ATP-dependent DNA helicase UvrD1 OS=Mycobacterium leprae (strain TN) GN=uvrD PE=3 SV=1 17 652 1.0E-117
sp|Q8NVT1|PCRA_STAAW ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain MW2) GN=pcrA PE=3 SV=1 17 652 1.0E-117
sp|Q6G828|PCRA_STAAS ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain MSSA476) GN=pcrA PE=3 SV=1 17 652 1.0E-117
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9S3Q0|PCRA_LEUCI ATP-dependent DNA helicase PcrA OS=Leuconostoc citreum GN=pcrA PE=3 SV=1 19 685 9.0E-126
sp|Q10213|SRS2_SCHPO ATP-dependent DNA helicase srs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srs2 PE=1 SV=1 15 647 2.0E-121
sp|Q9CD72|UVRD1_MYCLE ATP-dependent DNA helicase UvrD1 OS=Mycobacterium leprae (strain TN) GN=uvrD PE=3 SV=1 17 652 1.0E-117
sp|Q8NVT1|PCRA_STAAW ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain MW2) GN=pcrA PE=3 SV=1 17 652 1.0E-117
sp|Q6G828|PCRA_STAAS ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain MSSA476) GN=pcrA PE=3 SV=1 17 652 1.0E-117
sp|Q5HEL7|PCRA_STAAC ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain COL) GN=pcrA PE=3 SV=1 17 652 1.0E-117
sp|Q53727|PCRA_STAA8 ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain NCTC 8325) GN=pcrA PE=1 SV=3 17 652 1.0E-117
sp|P64319|PCRA_STAAN ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain N315) GN=pcrA PE=1 SV=1 17 652 2.0E-117
sp|P64318|PCRA_STAAM ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pcrA PE=3 SV=1 17 652 2.0E-117
sp|Q6GFF2|PCRA_STAAR ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain MRSA252) GN=pcrA PE=3 SV=1 17 652 2.0E-117
sp|Q8CRT9|PCRA_STAES ATP-dependent DNA helicase PcrA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pcrA PE=3 SV=1 17 670 2.0E-116
sp|Q5HN29|PCRA_STAEQ ATP-dependent DNA helicase PcrA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pcrA PE=3 SV=1 17 670 2.0E-116
sp|P9WMQ1|UVRD1_MYCTU ATP-dependent DNA helicase UvrD1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=uvrD1 PE=1 SV=1 17 652 2.0E-111
sp|P9WMQ0|UVRD1_MYCTO ATP-dependent DNA helicase UvrD1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=uvrD1 PE=3 SV=1 17 652 2.0E-111
sp|P0A5A4|UVRD1_MYCBO ATP-dependent DNA helicase UvrD1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=uvrD1 PE=3 SV=1 17 652 2.0E-111
sp|O34580|PCRA_BACSU ATP-dependent DNA helicase PcrA OS=Bacillus subtilis (strain 168) GN=pcrA PE=1 SV=1 13 652 1.0E-107
sp|P03018|UVRD_ECOLI DNA helicase II OS=Escherichia coli (strain K12) GN=uvrD PE=1 SV=1 15 654 8.0E-104
sp|P56255|PCRA_GEOSE ATP-dependent DNA helicase PcrA OS=Geobacillus stearothermophilus GN=pcrA PE=1 SV=1 13 652 2.0E-103
sp|Q9ZD95|UVRD_RICPR Probable DNA helicase II homolog OS=Rickettsia prowazekii (strain Madrid E) GN=uvrD PE=3 SV=1 16 654 5.0E-103
sp|Q05311|UVRD_SALTY DNA helicase II OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=uvrD PE=3 SV=2 15 654 3.0E-102
sp|Q68WT1|UVRD_RICTY DNA helicase II OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=uvrD PE=3 SV=1 16 654 4.0E-102
sp|Q4ULN5|UVRD_RICFE Probable DNA helicase II homolog OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=uvrD PE=3 SV=1 16 670 7.0E-102
sp|P57654|REP_BUCAI ATP-dependent DNA helicase Rep OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rep PE=3 SV=1 20 652 1.0E-101
sp|Q92HZ6|UVRD_RICCN Probable DNA helicase II homolog OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=uvrD PE=3 SV=1 16 670 3.0E-101
sp|Q1RIP8|UVRD_RICBR Probable DNA helicase II homolog OS=Rickettsia bellii (strain RML369-C) GN=uvrD PE=3 SV=1 16 670 4.0E-100
sp|P45612|UVRD_MYCCT Probable DNA helicase II homolog OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=uvrD PE=3 SV=2 36 647 3.0E-95
sp|Q02322|UVRD_HAEIN DNA helicase II OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=uvrD PE=1 SV=2 15 695 4.0E-95
sp|P44804|REP_HAEIN ATP-dependent DNA helicase Rep OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rep PE=3 SV=1 21 653 5.0E-95
sp|Q89A21|REP_BUCBP ATP-dependent DNA helicase Rep OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rep PE=3 SV=1 21 667 2.0E-90
sp|P09980|REP_ECOLI ATP-dependent DNA helicase Rep OS=Escherichia coli (strain K12) GN=rep PE=1 SV=3 21 653 3.0E-88
sp|Q9L6S1|REP_SALTY ATP-dependent DNA helicase Rep OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rep PE=3 SV=1 21 653 7.0E-87
sp|O51889|REP_BUCAP ATP-dependent DNA helicase Rep OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rep PE=3 SV=1 20 652 1.0E-86
sp|P12954|SRS2_YEAST ATP-dependent DNA helicase SRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRS2 PE=1 SV=2 17 650 2.0E-77
sp|O31626|YJCD_BACSU Putative ATP-dependent DNA helicase YjcD OS=Bacillus subtilis (strain 168) GN=yjcD PE=1 SV=1 20 672 2.0E-61
sp|D1KF50|SRS2L_ARATH ATP-dependent DNA helicase SRS2-like protein At4g25120 OS=Arabidopsis thaliana GN=SRS2 PE=1 SV=1 15 646 3.0E-57
sp|P75437|UVRD_MYCPN Probable DNA helicase II homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=uvrD PE=3 SV=1 19 663 4.0E-42
sp|P47486|UVRD_MYCGE Probable DNA helicase II homolog OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=uvrD PE=3 SV=1 21 381 6.0E-38
sp|P75438|Y340_MYCPN Probable DNA helicase MPN_340 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_340 PE=3 SV=1 18 381 1.0E-33
sp|P9WMP9|UVRD2_MYCTU ATP-dependent DNA helicase UvrD2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=uvrD2 PE=1 SV=1 12 440 1.0E-32
sp|P9WMP8|UVRD2_MYCTO ATP-dependent DNA helicase UvrD2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=uvrD2 PE=3 SV=1 12 440 1.0E-32
sp|P64321|UVRD2_MYCBO ATP-dependent DNA helicase UvrD2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=uvrD2 PE=3 SV=1 12 440 1.0E-32
sp|Q12039|HMI1_YEAST ATP-dependent DNA helicase HMI1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMI1 PE=1 SV=1 18 656 2.0E-26
sp|P53528|UVRD2_MYCLE ATP-dependent DNA helicase UvrD2 OS=Mycobacterium leprae (strain TN) GN=uvrD2 PE=3 SV=2 19 422 2.0E-24
sp|P15038|HELD_ECOLI Helicase IV OS=Escherichia coli (strain K12) GN=helD PE=1 SV=2 19 331 3.0E-19
sp|Q9CJI9|ADDA_LACLA ATP-dependent helicase/nuclease subunit A OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=addA PE=3 SV=1 190 651 2.0E-17
sp|Q04AN7|ADDA_LACDB ATP-dependent helicase/nuclease subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=addA PE=3 SV=1 240 651 7.0E-17
sp|Q1GAA9|ADDA_LACDA ATP-dependent helicase/nuclease subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=addA PE=3 SV=1 240 651 8.0E-17
sp|Q04GY7|ADDA_OENOB ATP-dependent helicase/nuclease subunit A OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=addA PE=3 SV=1 215 652 1.0E-16
sp|A7GM37|ADDA_BACCN ATP-dependent helicase/nuclease subunit A OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=addA PE=3 SV=1 202 653 2.0E-16
sp|Q8Y511|ADDA_LISMO ATP-dependent helicase/nuclease subunit A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=addA PE=3 SV=1 153 650 5.0E-16
sp|Q043G6|ADDA_LACGA ATP-dependent helicase/nuclease subunit A OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=addA PE=3 SV=1 239 678 1.0E-15
sp|A8YVK0|ADDA_LACH4 ATP-dependent helicase/nuclease subunit A OS=Lactobacillus helveticus (strain DPC 4571) GN=addA PE=3 SV=1 240 646 1.0E-15
sp|B8DF44|ADDA_LISMH ATP-dependent helicase/nuclease subunit A OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=addA PE=3 SV=1 153 650 2.0E-15
sp|B9DIS2|ADDA_STACT ATP-dependent helicase/nuclease subunit A OS=Staphylococcus carnosus (strain TM300) GN=addA PE=3 SV=1 163 651 2.0E-15
sp|A9VJ02|ADDA_BACWK ATP-dependent helicase/nuclease subunit A OS=Bacillus weihenstephanensis (strain KBAB4) GN=addA PE=3 SV=1 190 651 4.0E-15
sp|A0AL18|ADDA_LISW6 ATP-dependent helicase/nuclease subunit A OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=addA PE=3 SV=1 194 650 6.0E-15
sp|B7IL84|ADDA_BACC2 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain G9842) GN=addA PE=3 SV=1 190 651 1.0E-14
sp|Q81TW1|ADDA_BACAN ATP-dependent helicase/nuclease subunit A OS=Bacillus anthracis GN=addA PE=3 SV=1 190 651 1.0E-14
sp|A0RAX7|ADDA_BACAH ATP-dependent helicase/nuclease subunit A OS=Bacillus thuringiensis (strain Al Hakam) GN=addA PE=3 SV=1 190 651 1.0E-14
sp|Q73C23|ADDA_BACC1 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=addA PE=3 SV=1 190 651 1.0E-14
sp|B7HZR5|ADDA_BACC7 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain AH187) GN=addA PE=3 SV=1 190 651 1.0E-14
sp|A2RH77|ADDA_LACLM ATP-dependent helicase/nuclease subunit A OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=addA PE=1 SV=1 190 651 1.0E-14
sp|B9ITE9|ADDA_BACCQ ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain Q1) GN=addA PE=3 SV=1 190 651 1.0E-14
sp|Q63EM2|ADDA_BACCZ ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain ZK / E33L) GN=addA PE=3 SV=1 207 651 2.0E-14
sp|Q6HM43|ADDA_BACHK ATP-dependent helicase/nuclease subunit A OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=addA PE=3 SV=1 190 651 3.0E-14
sp|B7GM51|ADDA_ANOFW ATP-dependent helicase/nuclease subunit A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=addA PE=3 SV=1 239 651 3.0E-14
sp|B7JDU4|ADDA_BACC0 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain AH820) GN=addA PE=3 SV=1 190 651 3.0E-14
sp|Q71X99|ADDA_LISMF ATP-dependent helicase/nuclease subunit A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=addA PE=3 SV=1 153 650 5.0E-14
sp|A8FBR1|ADDA_BACP2 ATP-dependent helicase/nuclease subunit A OS=Bacillus pumilus (strain SAFR-032) GN=addA PE=3 SV=1 172 659 5.0E-14
sp|Q6GAV9|ADDA_STAAS ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain MSSA476) GN=addA PE=3 SV=1 197 651 5.0E-14
sp|Q74JA6|ADDA_LACJO ATP-dependent helicase/nuclease subunit A OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=addA PE=3 SV=1 239 678 5.0E-14
sp|A6QFH8|ADDA_STAAE ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain Newman) GN=addA PE=3 SV=1 197 651 6.0E-14
sp|Q5HHB7|ADDA_STAAC ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain COL) GN=addA PE=3 SV=1 197 651 6.0E-14
sp|Q2FZT5|ADDA_STAA8 ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain NCTC 8325) GN=addA PE=3 SV=1 197 651 6.0E-14
sp|A8Z073|ADDA_STAAT ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=addA PE=3 SV=1 197 651 6.0E-14
sp|Q2FIA8|ADDA_STAA3 ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain USA300) GN=addA PE=3 SV=1 197 651 6.0E-14
sp|Q81GP9|ADDA_BACCR ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=addA PE=3 SV=1 190 651 7.0E-14
sp|Q7A6H4|ADDA_STAAN ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain N315) GN=addA PE=1 SV=1 197 651 8.0E-14
sp|Q99VC3|ADDA_STAAM ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=addA PE=3 SV=1 197 651 8.0E-14
sp|A5IRE5|ADDA_STAA9 ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain JH9) GN=addA PE=3 SV=1 197 651 8.0E-14
sp|A6U074|ADDA_STAA2 ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain JH1) GN=addA PE=3 SV=1 197 651 8.0E-14
sp|A7X0I2|ADDA_STAA1 ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=addA PE=3 SV=1 197 651 8.0E-14
sp|Q8ERW5|ADDA_OCEIH ATP-dependent helicase/nuclease subunit A OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=addA PE=3 SV=1 239 650 8.0E-14
sp|Q8NXE9|ADDA_STAAW ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain MW2) GN=addA PE=3 SV=1 197 651 8.0E-14
sp|B7HGP9|ADDA_BACC4 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain B4264) GN=addA PE=3 SV=1 190 651 8.0E-14
sp|Q1WRS0|ADDA_LACS1 ATP-dependent helicase/nuclease subunit A OS=Lactobacillus salivarius (strain UCC118) GN=addA PE=3 SV=1 190 677 1.0E-13
sp|Q6GIC1|ADDA_STAAR ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain MRSA252) GN=addA PE=3 SV=1 197 651 2.0E-13
sp|Q8E5T9|ADDA_STRA3 ATP-dependent helicase/nuclease subunit A OS=Streptococcus agalactiae serotype III (strain NEM316) GN=addA PE=3 SV=1 194 647 2.0E-13
sp|A6TVN2|ADDA_ALKMQ ATP-dependent helicase/nuclease subunit A OS=Alkaliphilus metalliredigens (strain QYMF) GN=addA PE=3 SV=1 190 660 2.0E-13
sp|Q5FJX0|ADDA_LACAC ATP-dependent helicase/nuclease subunit A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=addA PE=3 SV=1 240 647 3.0E-13
sp|Q033I1|ADDA_LACLS ATP-dependent helicase/nuclease subunit A OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=addA PE=3 SV=1 190 651 4.0E-13
sp|A8MJ41|ADDA_ALKOO ATP-dependent helicase/nuclease subunit A OS=Alkaliphilus oremlandii (strain OhILAs) GN=addA PE=3 SV=1 190 651 4.0E-13
sp|A7Z368|ADDA_BACMF ATP-dependent helicase/nuclease subunit A OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=addA PE=3 SV=1 167 659 6.0E-13
sp|B1HN90|ADDA_LYSSC ATP-dependent helicase/nuclease subunit A OS=Lysinibacillus sphaericus (strain C3-41) GN=addA PE=3 SV=1 215 651 1.0E-12
sp|B1IBR6|ADDA_STRPI ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=addA PE=3 SV=1 194 647 3.0E-12
sp|B4U2H1|ADDA_STREM ATP-dependent helicase/nuclease subunit A OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=addA PE=3 SV=1 194 656 3.0E-12
sp|Q8DPR6|ADDA_STRR6 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=addA PE=3 SV=1 194 647 3.0E-12
sp|Q97QP9|ADDA_STRPN ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=addA PE=3 SV=1 194 647 3.0E-12
sp|Q04KF8|ADDA_STRP2 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=addA PE=3 SV=1 194 647 3.0E-12
sp|P23478|ADDA_BACSU ATP-dependent helicase/nuclease subunit A OS=Bacillus subtilis (strain 168) GN=addA PE=1 SV=2 241 798 4.0E-12
sp|C0MGY6|ADDA_STRS7 ATP-dependent helicase/nuclease subunit A OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=addA PE=3 SV=1 194 656 6.0E-12
sp|Q2YWW4|ADDA_STAAB ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=addA PE=3 SV=1 197 651 7.0E-12
sp|Q9A0H3|ADDA_STRP1 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M1 GN=addA PE=3 SV=2 189 614 7.0E-12
sp|Q8P1J2|ADDA_STRP8 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=addA PE=3 SV=1 190 614 1.0E-11
sp|B5XKR4|ADDA_STRPZ ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=addA PE=3 SV=1 190 614 2.0E-11
sp|Q1JMH5|ADDA_STRPC ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=addA PE=3 SV=1 190 614 2.0E-11
sp|Q1JCJ8|ADDA_STRPB ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=addA PE=3 SV=2 190 614 2.0E-11
sp|B2A610|ADDA_NATTJ ATP-dependent helicase/nuclease subunit A OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=addA PE=3 SV=1 190 651 3.0E-11
sp|Q3K1I4|ADDA_STRA1 ATP-dependent helicase/nuclease subunit A OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=addA PE=3 SV=1 194 647 3.0E-11
sp|Q1JHM1|ADDA_STRPD ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=addA PE=3 SV=1 190 614 3.0E-11
sp|Q5XCW6|ADDA_STRP6 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=addA PE=3 SV=1 190 614 3.0E-11
sp|Q8E061|ADDA_STRA5 ATP-dependent helicase/nuclease subunit A OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=addA PE=3 SV=1 194 647 4.0E-11
sp|Q1J7E4|ADDA_STRPF ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=addA PE=3 SV=1 190 614 4.0E-11
sp|A2RFA8|ADDA_STRPG ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=addA PE=3 SV=1 190 614 4.0E-11
sp|Q49WA6|ADDA_STAS1 ATP-dependent helicase/nuclease subunit A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=addA PE=3 SV=1 163 651 5.0E-11
sp|P0CZ53|ADDA_STRPQ ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=addA PE=3 SV=1 190 614 9.0E-11
sp|P0CZ52|ADDA_STRP3 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=addA PE=3 SV=1 190 614 9.0E-11
sp|B8I2Y2|ADDA_CLOCE ATP-dependent helicase/nuclease subunit A OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=addA PE=3 SV=1 178 647 2.0E-10
sp|B8ZQ32|ADDA_STRPJ ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=addA PE=3 SV=1 194 647 3.0E-10
sp|Q48UB8|ADDA_STRPM ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=addA PE=3 SV=1 190 614 3.0E-10
sp|Q8DT76|ADDA_STRMU ATP-dependent helicase/nuclease subunit A OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=addA PE=3 SV=1 194 614 7.0E-10
sp|B9DZK4|ADDA_CLOK1 ATP-dependent helicase/nuclease subunit A OS=Clostridium kluyveri (strain NBRC 12016) GN=addA PE=3 SV=1 32 135 1.0E-09
sp|A5N628|ADDA_CLOK5 ATP-dependent helicase/nuclease subunit A OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=addA PE=3 SV=1 32 135 1.0E-09
sp|O84645|RECB_CHLTR RecBCD enzyme subunit RecB OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=recB PE=3 SV=1 241 315 2.0E-09
sp|Q9PLT8|RECB_CHLMU RecBCD enzyme subunit RecB OS=Chlamydia muridarum (strain MoPn / Nigg) GN=recB PE=3 SV=2 241 315 2.0E-09
sp|B2IPX3|ADDA_STRPS ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae (strain CGSP14) GN=addA PE=3 SV=1 194 453 2.0E-09
sp|B1I493|ADDA_DESAP ATP-dependent helicase/nuclease subunit A OS=Desulforudis audaxviator (strain MP104C) GN=addA PE=3 SV=1 37 141 2.0E-09
sp|B1MZM2|ADDA_LEUCK ATP-dependent helicase/nuclease subunit A OS=Leuconostoc citreum (strain KM20) GN=addA PE=3 SV=1 240 426 3.0E-09
sp|B9DRV0|ADDA_STRU0 ATP-dependent helicase/nuclease subunit A OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=addA PE=3 SV=1 196 614 4.0E-09
sp|B2THC8|ADDA_CLOBB ATP-dependent helicase/nuclease subunit A OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=addA PE=3 SV=1 192 659 5.0E-09
sp|Q0AXU8|ADDA_SYNWW ATP-dependent helicase/nuclease subunit A OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=addA PE=3 SV=1 187 315 6.0E-09
sp|B5E4P5|ADDA_STRP4 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=addA PE=3 SV=1 194 453 6.0E-09
sp|P9WMP9|UVRD2_MYCTU ATP-dependent DNA helicase UvrD2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=uvrD2 PE=1 SV=1 590 684 1.0E-08
sp|P9WMP8|UVRD2_MYCTO ATP-dependent DNA helicase UvrD2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=uvrD2 PE=3 SV=1 590 684 1.0E-08
sp|P64321|UVRD2_MYCBO ATP-dependent DNA helicase UvrD2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=uvrD2 PE=3 SV=1 590 684 1.0E-08
sp|P53528|UVRD2_MYCLE ATP-dependent DNA helicase UvrD2 OS=Mycobacterium leprae (strain TN) GN=uvrD2 PE=3 SV=2 590 652 1.0E-08
sp|B7GM51|ADDA_ANOFW ATP-dependent helicase/nuclease subunit A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=addA PE=3 SV=1 19 146 1.0E-08
sp|A6TVN2|ADDA_ALKMQ ATP-dependent helicase/nuclease subunit A OS=Alkaliphilus metalliredigens (strain QYMF) GN=addA PE=3 SV=1 23 132 2.0E-08
sp|A8MJ41|ADDA_ALKOO ATP-dependent helicase/nuclease subunit A OS=Alkaliphilus oremlandii (strain OhILAs) GN=addA PE=3 SV=1 27 132 4.0E-08
sp|B2A610|ADDA_NATTJ ATP-dependent helicase/nuclease subunit A OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=addA PE=3 SV=1 39 127 4.0E-08
sp|P47486|UVRD_MYCGE Probable DNA helicase II homolog OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=uvrD PE=3 SV=1 577 651 6.0E-08
sp|Q0AXU8|ADDA_SYNWW ATP-dependent helicase/nuclease subunit A OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=addA PE=3 SV=1 37 141 1.0E-07
sp|A7GAJ8|ADDA_CLOBL ATP-dependent helicase/nuclease subunit A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=addA PE=3 SV=1 25 132 1.0E-07
sp|A0PY67|ADDA_CLONN ATP-dependent helicase/nuclease subunit A OS=Clostridium novyi (strain NT) GN=addA PE=3 SV=1 37 132 1.0E-07
sp|Q18AN9|ADDA_PEPD6 ATP-dependent helicase/nuclease subunit A OS=Peptoclostridium difficile (strain 630) GN=addA PE=3 SV=1 25 157 1.0E-07
sp|B1YKM8|ADDA_EXIS2 ATP-dependent helicase/nuclease subunit A OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=addA PE=3 SV=1 191 651 2.0E-07
sp|Q9Z7G7|RECB_CHLPN RecBCD enzyme subunit RecB OS=Chlamydia pneumoniae GN=recB PE=3 SV=2 241 315 2.0E-07
sp|Q5M2T7|ADDA_STRT2 ATP-dependent helicase/nuclease subunit A OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=addA PE=3 SV=1 194 456 2.0E-07
sp|Q5LY80|ADDA_STRT1 ATP-dependent helicase/nuclease subunit A OS=Streptococcus thermophilus (strain CNRZ 1066) GN=addA PE=3 SV=1 194 456 2.0E-07
sp|Q03IZ8|ADDA_STRTD ATP-dependent helicase/nuclease subunit A OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=addA PE=3 SV=1 194 456 2.0E-07
sp|B9DIS2|ADDA_STACT ATP-dependent helicase/nuclease subunit A OS=Staphylococcus carnosus (strain TM300) GN=addA PE=3 SV=1 39 162 3.0E-07
sp|P57529|RECB_BUCAI RecBCD enzyme subunit RecB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=recB PE=3 SV=1 242 661 3.0E-07
sp|A3CNT9|ADDA_STRSV ATP-dependent helicase/nuclease subunit A OS=Streptococcus sanguinis (strain SK36) GN=addA PE=3 SV=1 190 316 5.0E-07
sp|Q74JA6|ADDA_LACJO ATP-dependent helicase/nuclease subunit A OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=addA PE=3 SV=1 41 210 1.0E-06
sp|B0KDB7|ADDA_THEP3 ATP-dependent helicase/nuclease subunit A OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=addA PE=3 SV=1 25 132 1.0E-06
sp|B0K213|ADDA_THEPX ATP-dependent helicase/nuclease subunit A OS=Thermoanaerobacter sp. (strain X514) GN=addA PE=3 SV=1 25 132 1.0E-06
sp|Q4L4Y3|ADDA_STAHJ ATP-dependent helicase/nuclease subunit A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=addA PE=3 SV=1 39 130 1.0E-06
sp|Q03D71|ADDA_PEDPA ATP-dependent helicase/nuclease subunit A OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=addA PE=3 SV=1 24 151 1.0E-06
sp|A8FBR1|ADDA_BACP2 ATP-dependent helicase/nuclease subunit A OS=Bacillus pumilus (strain SAFR-032) GN=addA PE=3 SV=1 39 145 2.0E-06
sp|Q8RCZ0|ADDA_CALS4 ATP-dependent helicase/nuclease subunit A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=addA PE=3 SV=1 39 132 2.0E-06
sp|A6LPC4|ADDA_CLOB8 ATP-dependent helicase/nuclease subunit A OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=addA PE=3 SV=1 25 141 2.0E-06
sp|Q03W49|ADDA_LEUMM ATP-dependent helicase/nuclease subunit A OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=addA PE=3 SV=1 164 322 2.0E-06
sp|Q04AN7|ADDA_LACDB ATP-dependent helicase/nuclease subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=addA PE=3 SV=1 37 187 3.0E-06
sp|Q1GAA9|ADDA_LACDA ATP-dependent helicase/nuclease subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=addA PE=3 SV=1 37 187 3.0E-06
sp|B2THC8|ADDA_CLOBB ATP-dependent helicase/nuclease subunit A OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=addA PE=3 SV=1 25 140 3.0E-06
sp|A8AY33|ADDA_STRGC ATP-dependent helicase/nuclease subunit A OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=addA PE=3 SV=1 197 316 3.0E-06
sp|Q49WA6|ADDA_STAS1 ATP-dependent helicase/nuclease subunit A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=addA PE=3 SV=1 39 130 4.0E-06
sp|B2UX57|ADDA_CLOBA ATP-dependent helicase/nuclease subunit A OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=addA PE=3 SV=1 25 140 4.0E-06
sp|A4J4E3|ADDA_DESRM ATP-dependent helicase/nuclease subunit A OS=Desulfotomaculum reducens (strain MI-1) GN=addA PE=3 SV=1 47 135 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|063500
MLSATVNVNSGSIGSDFLSSLNSAQLQAVQHSPSIPLQILAGPGSGKTKVLISRVAHLICHHDIAPSSICAVTFT
NKAANEMRQRLTKLLGDEITSQIKMGTFHALCANFLRRYGNAIALERNFTVCDAEESKKLITEFFKPYKAELAQT
DITLKESTILDKISKAKAKGFDAAAMREACNAARSLIPSITDQINSIVSDIYENYEKALNRSNSLDFDDLLLFGV
KLFRNHPKAVDWCSHVLIDEFQDTNIIQYELMVELAVHKCITVVGDPDQSIYGWRSAEIGNLTRMQKDYPKTEQI
FLEENYRSTGSILNASLAIVAQDKTRVQKSLFTSHPTGSTPVLCALQDEHDEARHIASEIKRVVAYTGSLLNYGD
FAILLRFTALSRTLESALQKEGIPSRVLGGHKFFERLEVKDLLAYLQLIDNSDYNPAFIRAVNVPSRGVGDKTLD
GLSSIAQSKNLSMLALVQNICDNRIPDLKPPIKRKLGNFIKVIQKLKRFASEGMSPPDLLHQLLELVDYENHLKK
TQKDWESRWENVKELITFASEVNTDSPPLGEEELELVERPTPLRLFLQASMLSSEGDGDKENQKEKVTLVTCHAA
KGLEWPVVFIPSVDDGIFPFYRTDDVEEERRLLYVACTRAQCLLYLTRTMKRKVAAVMKNKYISPFVSAVQKQSP
ALFTDVPPGLDVSQIHAMSHMLGRPEPDKEQIQKQIEEYRQRFPEQEYPGPATPSPDYRARTQDYNPLNPPGFIS
SSQTLSQTQGINNSQHWRRPTFMAANSSQPVQAGFAHSTSKVPLIKRALSLQVPLVPTNTPTGVNQVLQRIDPSS
FNKPEAPRGTFDAGPKTSRSWSKQYWLRK*
Coding >AgabiH97|063500
ATGCTCTCAGCTACAGTCAACGTTAATTCTGGGTCAATTGGTTCTGATTTCTTATCCTCCTTGAATTCGGCTCAG
CTTCAAGCCGTCCAACATTCACCTTCAATACCCCTGCAAATTCTGGCAGGTCCTGGAAGTGGGAAGACCAAAGTC
CTCATATCTCGAGTTGCTCACCTTATTTGTCACCATGACATAGCTCCCTCTTCAATATGTGCGGTCACCTTTACC
AACAAGGCTGCAAACGAGATGCGACAACGCTTGACGAAGCTTCTCGGTGATGAAATTACGAGTCAGATCAAGATG
GGAACGTTTCATGCATTATGCGCCAATTTCTTGCGACGATACGGCAATGCCATTGCTCTCGAGCGAAATTTTACT
GTGTGCGACGCAGAGGAGAGTAAGAAACTTATAACGGAATTTTTCAAGCCTTACAAGGCAGAACTCGCGCAAACC
GATATCACACTCAAAGAATCAACTATACTAGACAAGATTTCCAAAGCAAAGGCAAAAGGGTTTGATGCTGCAGCT
ATGCGTGAAGCGTGCAACGCAGCTCGGTCCCTCATACCATCAATTACCGACCAAATCAATTCCATTGTGTCAGAT
ATATATGAAAACTATGAGAAGGCGCTGAACCGGTCAAATTCCCTAGACTTTGATGATCTTCTGCTCTTTGGAGTA
AAATTGTTCCGAAACCATCCGAAGGCAGTTGACTGGTGTAGTCATGTCTTGATTGACGAATTTCAGGATACCAAT
ATCATCCAATACGAGCTAATGGTTGAACTCGCTGTGCACAAGTGTATAACGGTTGTGGGGGACCCTGACCAGTCT
ATCTACGGTTGGCGCTCCGCGGAAATTGGAAACTTGACCAGGATGCAAAAAGACTATCCCAAAACAGAGCAGATT
TTTCTGGAGGAAAATTATCGGTCAACCGGTTCTATACTAAACGCAAGTTTGGCAATTGTTGCGCAAGACAAAACA
CGCGTCCAGAAATCACTGTTCACGTCACACCCGACCGGAAGCACACCGGTCCTGTGTGCTTTGCAGGATGAACAT
GACGAGGCTAGACATATTGCTTCTGAAATCAAACGAGTTGTCGCCTATACGGGTAGTCTTCTTAACTACGGAGAT
TTTGCCATTCTTCTAAGGTTCACAGCTTTGTCTCGTACACTGGAGAGTGCGCTCCAAAAAGAGGGCATTCCCAGT
CGCGTTTTAGGAGGACACAAATTTTTCGAGCGTTTGGAGGTCAAAGACTTGCTCGCATATCTTCAATTAATCGAT
AATTCGGACTATAATCCTGCATTTATCCGCGCGGTGAACGTTCCAAGTCGTGGAGTCGGAGACAAGACCCTAGAC
GGACTATCTTCCATAGCTCAGAGTAAAAACCTATCAATGCTCGCACTTGTTCAAAACATCTGTGATAACCGTATT
CCGGATCTCAAGCCTCCAATCAAGCGCAAGCTGGGGAACTTTATCAAGGTCATTCAAAAATTGAAAAGATTTGCG
TCCGAGGGTATGTCACCACCCGACCTTCTACATCAGTTACTTGAGCTGGTAGACTATGAGAATCATCTAAAGAAG
ACTCAAAAGGATTGGGAATCAAGATGGGAGAACGTGAAGGAGCTGATAACCTTTGCAAGTGAAGTTAACACCGAT
AGTCCTCCTCTGGGCGAAGAAGAACTAGAACTCGTCGAACGTCCAACACCCCTGCGACTTTTCTTACAGGCTTCA
ATGCTATCATCGGAAGGTGATGGCGACAAGGAAAACCAGAAAGAGAAAGTTACGCTCGTCACTTGCCACGCTGCC
AAAGGTTTGGAATGGCCAGTGGTATTTATTCCCTCTGTCGATGATGGAATCTTTCCGTTCTATAGAACAGACGAT
GTAGAAGAAGAGAGACGATTGCTCTATGTAGCGTGCACTCGTGCCCAATGTCTTCTTTATCTCACACGCACAATG
AAGAGAAAAGTGGCAGCGGTAATGAAAAATAAGTATATTTCCCCTTTTGTTTCAGCCGTTCAGAAGCAGTCTCCG
GCTCTATTTACAGATGTACCTCCAGGTCTTGACGTTTCGCAGATTCACGCGATGTCACATATGTTAGGTCGTCCT
GAGCCTGACAAAGAACAAATTCAGAAGCAAATCGAAGAATATCGTCAACGTTTCCCGGAACAGGAGTATCCAGGG
CCGGCGACCCCAAGCCCGGATTATCGTGCGAGGACGCAGGACTATAACCCCTTGAATCCCCCAGGGTTTATTTCC
TCAAGCCAAACCCTTAGCCAGACTCAGGGCATTAACAATTCGCAACACTGGCGACGTCCGACATTCATGGCAGCC
AACAGCTCTCAACCGGTTCAAGCCGGATTTGCACACTCTACATCCAAAGTGCCTTTGATAAAGAGAGCGTTATCC
TTGCAAGTGCCGTTGGTACCTACAAATACTCCTACGGGAGTGAACCAAGTGCTTCAGCGGATTGATCCGTCGTCG
TTTAATAAGCCCGAAGCTCCGCGAGGCACATTCGATGCTGGTCCTAAGACGTCTCGGAGTTGGTCGAAACAATAC
TGGCTACGCAAATAA
Transcript >AgabiH97|063500
ATGCTCTCAGCTACAGTCAACGTTAATTCTGGGTCAATTGGTTCTGATTTCTTATCCTCCTTGAATTCGGCTCAG
CTTCAAGCCGTCCAACATTCACCTTCAATACCCCTGCAAATTCTGGCAGGTCCTGGAAGTGGGAAGACCAAAGTC
CTCATATCTCGAGTTGCTCACCTTATTTGTCACCATGACATAGCTCCCTCTTCAATATGTGCGGTCACCTTTACC
AACAAGGCTGCAAACGAGATGCGACAACGCTTGACGAAGCTTCTCGGTGATGAAATTACGAGTCAGATCAAGATG
GGAACGTTTCATGCATTATGCGCCAATTTCTTGCGACGATACGGCAATGCCATTGCTCTCGAGCGAAATTTTACT
GTGTGCGACGCAGAGGAGAGTAAGAAACTTATAACGGAATTTTTCAAGCCTTACAAGGCAGAACTCGCGCAAACC
GATATCACACTCAAAGAATCAACTATACTAGACAAGATTTCCAAAGCAAAGGCAAAAGGGTTTGATGCTGCAGCT
ATGCGTGAAGCGTGCAACGCAGCTCGGTCCCTCATACCATCAATTACCGACCAAATCAATTCCATTGTGTCAGAT
ATATATGAAAACTATGAGAAGGCGCTGAACCGGTCAAATTCCCTAGACTTTGATGATCTTCTGCTCTTTGGAGTA
AAATTGTTCCGAAACCATCCGAAGGCAGTTGACTGGTGTAGTCATGTCTTGATTGACGAATTTCAGGATACCAAT
ATCATCCAATACGAGCTAATGGTTGAACTCGCTGTGCACAAGTGTATAACGGTTGTGGGGGACCCTGACCAGTCT
ATCTACGGTTGGCGCTCCGCGGAAATTGGAAACTTGACCAGGATGCAAAAAGACTATCCCAAAACAGAGCAGATT
TTTCTGGAGGAAAATTATCGGTCAACCGGTTCTATACTAAACGCAAGTTTGGCAATTGTTGCGCAAGACAAAACA
CGCGTCCAGAAATCACTGTTCACGTCACACCCGACCGGAAGCACACCGGTCCTGTGTGCTTTGCAGGATGAACAT
GACGAGGCTAGACATATTGCTTCTGAAATCAAACGAGTTGTCGCCTATACGGGTAGTCTTCTTAACTACGGAGAT
TTTGCCATTCTTCTAAGGTTCACAGCTTTGTCTCGTACACTGGAGAGTGCGCTCCAAAAAGAGGGCATTCCCAGT
CGCGTTTTAGGAGGACACAAATTTTTCGAGCGTTTGGAGGTCAAAGACTTGCTCGCATATCTTCAATTAATCGAT
AATTCGGACTATAATCCTGCATTTATCCGCGCGGTGAACGTTCCAAGTCGTGGAGTCGGAGACAAGACCCTAGAC
GGACTATCTTCCATAGCTCAGAGTAAAAACCTATCAATGCTCGCACTTGTTCAAAACATCTGTGATAACCGTATT
CCGGATCTCAAGCCTCCAATCAAGCGCAAGCTGGGGAACTTTATCAAGGTCATTCAAAAATTGAAAAGATTTGCG
TCCGAGGGTATGTCACCACCCGACCTTCTACATCAGTTACTTGAGCTGGTAGACTATGAGAATCATCTAAAGAAG
ACTCAAAAGGATTGGGAATCAAGATGGGAGAACGTGAAGGAGCTGATAACCTTTGCAAGTGAAGTTAACACCGAT
AGTCCTCCTCTGGGCGAAGAAGAACTAGAACTCGTCGAACGTCCAACACCCCTGCGACTTTTCTTACAGGCTTCA
ATGCTATCATCGGAAGGTGATGGCGACAAGGAAAACCAGAAAGAGAAAGTTACGCTCGTCACTTGCCACGCTGCC
AAAGGTTTGGAATGGCCAGTGGTATTTATTCCCTCTGTCGATGATGGAATCTTTCCGTTCTATAGAACAGACGAT
GTAGAAGAAGAGAGACGATTGCTCTATGTAGCGTGCACTCGTGCCCAATGTCTTCTTTATCTCACACGCACAATG
AAGAGAAAAGTGGCAGCGGTAATGAAAAATAAGTATATTTCCCCTTTTGTTTCAGCCGTTCAGAAGCAGTCTCCG
GCTCTATTTACAGATGTACCTCCAGGTCTTGACGTTTCGCAGATTCACGCGATGTCACATATGTTAGGTCGTCCT
GAGCCTGACAAAGAACAAATTCAGAAGCAAATCGAAGAATATCGTCAACGTTTCCCGGAACAGGAGTATCCAGGG
CCGGCGACCCCAAGCCCGGATTATCGTGCGAGGACGCAGGACTATAACCCCTTGAATCCCCCAGGGTTTATTTCC
TCAAGCCAAACCCTTAGCCAGACTCAGGGCATTAACAATTCGCAACACTGGCGACGTCCGACATTCATGGCAGCC
AACAGCTCTCAACCGGTTCAAGCCGGATTTGCACACTCTACATCCAAAGTGCCTTTGATAAAGAGAGCGTTATCC
TTGCAAGTGCCGTTGGTACCTACAAATACTCCTACGGGAGTGAACCAAGTGCTTCAGCGGATTGATCCGTCGTCG
TTTAATAAGCCCGAAGCTCCGCGAGGCACATTCGATGCTGGTCCTAAGACGTCTCGGAGTTGGTCGAAACAATAC
TGGCTACGCAAATAA
Gene >AgabiH97|063500
ATGCTCTCAGCTACAGTCAACGTTAATTCTGGGTCAATTGGTTCTGATTTCTTATCCTCCTTGAATTCGGCTCAG
CTTCAAGGTACAGCATATAGCCACGGTATTTTGACGGAAGTTTGTGTATCTAACTTCGCCGACAGCCGTCCAACA
TTCACCTTCAATACCCCTGCAAATTCTGGCAGGTCCTGGAAGTGGGAAGACCAAAGTTTGTTCAACTGCTTCTTA
CCATAATGCTCTCTAACGGTCCCGTACAGGTCCTCATATCTCGAGTTGCTCACCTTATTTGTCACCATGACATAG
CTCCCTCTTCAATATGTGCGGTCACCTTTACCAACAAGGCTGCAAACGAGATGCGACAACGCTTGACGAAGCTTC
TCGGTGATGAAATTACGAGTCAGATCAAGATGGGAACGTTTCATGCATTATGCGCCAATTTCTTGCGACGATACG
GCAATGCCATTGCTCTCGAGCGAAATTTTACTGTGTGCGACGCAGAGGAGAGGTAAGAATATCGCCATCTTGTCA
ATCGATATGCATGTACTCACCCACGAGAAGTAAGAAACTTATAACGGAATTTTTCAAGCCTTACAAGGCAGAACT
CGCGCAAACCGATATCACACTCAAAGAATCAACTATACTAGACAAGATTTCCAAAGCAAAGGCAAAAGGGTTTGA
TGCTGCAGCTATGCGTGAAGCGTGCAACGCAGCTCGGTCCCTCATACCATCAATTACCGACCAAATCAATTCCAT
TGTGTCAGATATATATGAAAACTATGAGAAGGCGCTGAACCGGTCAAATTCCCTAGACTTTGATGATCTTCTGCT
CTTTGGAGTAAAATTGTTCCGAAACCATCCGAAGGCAGTTGACTGGTGTAGTCATGTCTTGATTGACGAATTGTA
TGTTCTGGTCCTGTCTTCCTGTCAGTATACTTATGATGGCTATTACTCAGTCAGGATACCAATATCATCCAATAC
GAGCTAATGGTTGAACTCGCTGTGCACAAGTGTATAACGGTTGTGGGGGACCCTGACCAGTCTAGTAACAAGTTT
TCTAGACCCTAAAACCCATATCTTATTCGCTTCTAGTCTACGGTTGGCGCTCCGCGGAAATTGGAAACTTGACCA
GGATGCAAAAAGGTATGAGCCGACGCCCTCCATCGAAAAGGTCTATATCCAATCATAACCTCTTCAAACTGTCAG
ACTATCCCAAAACAGAGCAGATTTTTCTGGAGGAAAATTATCGGTCAACCGGTTCTATACTAAACGCAAGTTTGG
CAATTGTTGCGCAAGGTGTGTATCAGCTAAGATTTATGCGCATATACTTATGTTCTACAGACAAAACACGCGTCC
AGAAATCACTGTTCACGTCACACCCGACCGGAAGCACACCGGTCCTGTGTGCTTTGCAGGATGAACATGACGAGG
CTAGACATATTGCTTCTGAAATCAAACGAGTTGTCGCCTATACGGGTAGTCTTCTTAACTACGGAGATTTTGCCA
TTCTTCGTGAGGCCACTTATCTCATATTCTAGTCAAATGAACTGATGGTAAATTACTAGTAAGGTTCACAGCTTT
GTCTCGTACACTGGAGAGTGCGCTCCAAAAAGAGGGCATTCCCAGTCGCGTTTTAGGAGGACACAAATTTTTCGA
GCGTTTGGAGGTCAGCACTTCTTTTTCGTATAGGAGTTACTGGATCGTTAACATCGCTGACTGCCCTTAGGTCAA
AGACTTGCTCGCATATCTTCAATTAATCGATAATTCGGACTATAATCCTGCATTTATCCGCGCGGTGAACGTTCC
AAGTCGTGGAGTCGGAGACAAGGTGAGCGACAACTTGAACGGTAATATTTTCTTCTCCTAAATTACGCTTCTGCT
AGACCCTAGACGGACTATCTTCCATAGCTCAGAGTAAAAACCTATCAATGCTCGCACTTGTTCAAAACATCTGTG
ATAACCGTATTCCGGATCTCAAGCCTCCAATCAAGCGCAAGCTGGGGAACTTTATCAAGGTCATTCAAAAATTGA
AAAGATTTGCGTCCGAGGTAGGCCCCCATAAATCATATGACCTAGTATGCACTGACCATTTTATCTAGGGTATGT
CACCACCCGACCTTCTACATCAGTTACTTGAGCTGGTAGACTATGAGAATCATCTAAAGAAGACTCAAAAGGATT
GGGAATCAAGATGGGAGAACGTGAAGGAGCTGATAACCTTTGCAAGTGAAGTTAACACCGATAGTCCTCCTCTGG
GCGAAGAAGAACTAGAACTCGTCGAACGGTGAGGTTTGCTCAACTCTGTGATCACCAATTCTCATAAATTCCAGT
CCAACACCCCTGCGACTTTTCTTACAGGCTTCAATGCTATCATCGGAAGGTGATGGCGACAAGGAAAACCAGAAA
GAGGTATGTCTTTTTTCGTTCTTCACCTGACTTGACTTTAGTGTTGACGCGGACGCTTAACAGAAAGTTACGCTC
GTCACTTGCCACGCTGCCAAAGGTTTGGAATGGCCAGTGGTATTTATTCCCTCTGGTAATGCCTTTGGTCGGGCT
GTCTGCGATTCCTCTCTGACGTTCTGTCAGTCGATGATGGAATCTTTCCGTTCTATAGAACAGACGATGTAGAAG
AAGAGAGGTGAGTCTTAACAAAAACTGAAGGTAGCATGATGCCAATGAAGCAACTAGACGATTGCTCTATGTAGC
GTGCACTCGTGCCCAATGTCTTCTTTATCTCACACGCACAATGAAGAGAAAAGTGGCAGCGGTAATGAAAAATAA
GTATATTTCCCCTTTTGTTTCAGCCGTTCAGAAGCAGTCTCCGGTATGTAACCATCTTCTTGTTCTTCTCCCAGT
AGAGGTTGATTCTCGTAGGCTCTATTTACAGATGTACCTCCAGGTCTTGACGTTTCGCAGATTCACGCGATGTCA
CATATGTTAGGTCGTCCTGAGCCTGACAAAGAACAAATTCAGAAGCAAATCGAAGAATAGTGCGTTATAAAAAAA
CTTGCTTGAAATGCGGCTGATGAAGCCATGGTCTAGTCGTCAACGTTTCCCGGAACAGGAGTATCCAGGGCCGGC
GACCCCAAGCCCGGATTATCGTGCGAGGACGCAGGACTATAACCCCTTGAATCCCCCAGGGTTTATTTCCTCAAG
CCAAACCCTTAGCCAGACTCAGGGCATTAACAATTCGCAACACTGGCGACGTCCGACATTCATGGCAGCCAACAG
CTCTCAACCGGTTCAAGCCGGATTTGCACACTCTACATCCAAAGTGCCTTTGATAAAGAGAGCGTTATCCTTGCA
AGTGCCGTTGGTACCTACAAATACTCCTACGGGAGTGAACCAAGTGCTTCAGCGGATTGATCCGTCGTCGTTTAA
TAAGCCCGAAGCTCCGCGAGGCACATTCGATGCTGGTCCTAGTGCGACTGAAGCGACCAGTGAAGACCAAAACTT
GCCTTTACATCCTGGTACCAAGAGACGTCTCGGAGTTGGTCGAAACAATACTGGCTACGCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail