Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|063390
Gene name
Locationscaffold_3:2576476..2579372
Strand+
Gene length (bp)2896
Transcript length (bp)2619
Coding sequence length (bp)2619
Protein length (aa) 873

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15913 Furin-like_2 Furin-like repeat, cysteine-rich 6.6E-07 473 540
PF00053 Laminin_EGF Laminin EGF domain 6.1E-05 206 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 207 626 4.0E-27
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 311 625 1.0E-26
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 222 626 1.0E-23
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 310 626 2.0E-23
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 355 640 6.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 207 626 4.0E-27
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 311 625 1.0E-26
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 222 626 1.0E-23
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 310 626 2.0E-23
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 355 640 6.0E-23
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 355 617 7.0E-23
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 232 640 1.0E-21
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 308 625 4.0E-21
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 303 636 4.0E-21
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 246 640 5.0E-21
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 306 626 5.0E-21
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 303 636 2.0E-20
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 303 627 2.0E-20
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 301 619 4.0E-20
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 230 619 7.0E-20
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 301 634 3.0E-19
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 380 626 6.0E-19
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 301 626 7.0E-19
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 308 627 1.0E-18
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 230 628 2.0E-18
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 310 614 2.0E-18
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 230 627 2.0E-18
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 303 613 4.0E-18
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 381 616 4.0E-18
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 310 626 5.0E-18
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 382 625 1.0E-17
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 307 582 1.0E-17
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 290 624 3.0E-17
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 309 627 4.0E-17
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 304 626 5.0E-17
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 246 624 8.0E-17
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 303 626 3.0E-16
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 231 638 4.0E-16
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 461 627 2.0E-15
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 382 616 3.0E-15
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 222 625 3.0E-15
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 310 625 6.0E-15
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 307 579 1.0E-14
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 304 625 1.0E-14
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 461 627 3.0E-14
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 310 640 8.0E-14
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 314 602 4.0E-13
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 314 608 4.0E-12
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 369 563 3.0E-11
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 368 563 4.0E-11
sp|P92127|VS41_GIAIN Variant-specific surface protein VSP4A1 OS=Giardia intestinalis PE=1 SV=1 460 642 2.0E-10
sp|Q9Y6N6|LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens GN=LAMC3 PE=1 SV=3 204 325 1.0E-09
sp|P55268|LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens GN=LAMB2 PE=1 SV=2 207 470 2.0E-09
sp|P02469|LAMB1_MOUSE Laminin subunit beta-1 OS=Mus musculus GN=Lamb1 PE=1 SV=3 142 596 2.0E-08
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 461 625 3.0E-08
sp|Q9CYA0|CREL2_MOUSE Cysteine-rich with EGF-like domain protein 2 OS=Mus musculus GN=Creld2 PE=1 SV=1 238 417 3.0E-08
sp|P0CY46|EGFR_APIME Epidermal growth factor receptor OS=Apis mellifera GN=Egfr PE=2 SV=1 379 716 4.0E-08
sp|Q6UXH1|CREL2_HUMAN Cysteine-rich with EGF-like domain protein 2 OS=Homo sapiens GN=CRELD2 PE=1 SV=1 238 440 4.0E-08
sp|P15800|LAMB2_RAT Laminin subunit beta-2 OS=Rattus norvegicus GN=Lamb2 PE=2 SV=1 110 470 7.0E-08
sp|O15230|LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens GN=LAMA5 PE=1 SV=8 179 347 7.0E-08
sp|Q8R4U0|STAB2_MOUSE Stabilin-2 OS=Mus musculus GN=Stab2 PE=1 SV=1 221 268 8.0E-08
sp|Q61292|LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus GN=Lamb2 PE=1 SV=2 136 470 9.0E-08
sp|P35590|TIE1_HUMAN Tyrosine-protein kinase receptor Tie-1 OS=Homo sapiens GN=TIE1 PE=1 SV=1 135 313 1.0E-07
sp|Q9R0B6|LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus GN=Lamc3 PE=1 SV=2 204 325 2.0E-07
sp|Q4G063|CREL2_RAT Cysteine-rich with EGF-like domain protein 2 OS=Rattus norvegicus GN=Creld2 PE=1 SV=1 238 417 3.0E-07
sp|Q8R4Y4|STAB1_MOUSE Stabilin-1 OS=Mus musculus GN=Stab1 PE=1 SV=1 221 268 3.0E-07
sp|Q61001|LAMA5_MOUSE Laminin subunit alpha-5 OS=Mus musculus GN=Lama5 PE=1 SV=4 219 346 3.0E-07
sp|Q9H1U4|MEGF9_HUMAN Multiple epidermal growth factor-like domains protein 9 OS=Homo sapiens GN=MEGF9 PE=2 SV=3 185 412 4.0E-07
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 246 483 5.0E-07
sp|A0JP86|LAMC1_XENTR Laminin subunit gamma-1 OS=Xenopus tropicalis GN=lamc1 PE=2 SV=1 217 325 5.0E-07
sp|Q21313|EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans GN=epi-1 PE=1 SV=1 207 408 6.0E-07
sp|P11046|LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster GN=LanB1 PE=1 SV=4 206 350 7.0E-07
sp|Q2KIT5|CREL2_BOVIN Cysteine-rich with EGF-like domain protein 2 OS=Bos taurus GN=CRELD2 PE=2 SV=1 238 412 8.0E-07
sp|Q21313|EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans GN=epi-1 PE=1 SV=1 206 362 9.0E-07
sp|Q96KG7|MEG10_HUMAN Multiple epidermal growth factor-like domains protein 10 OS=Homo sapiens GN=MEGF10 PE=1 SV=1 217 666 9.0E-07
sp|Q06805|TIE1_BOVIN Tyrosine-protein kinase receptor Tie-1 OS=Bos taurus GN=TIE1 PE=2 SV=1 135 313 1.0E-06
sp|Q06807|TIE2_BOVIN Angiopoietin-1 receptor OS=Bos taurus GN=TEK PE=2 SV=1 211 311 1.0E-06
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 461 625 2.0E-06
sp|Q8CFM6|STAB2_RAT Stabilin-2 (Fragment) OS=Rattus norvegicus GN=Stab2 PE=1 SV=1 222 308 2.0E-06
sp|Q06806|TIE1_MOUSE Tyrosine-protein kinase receptor Tie-1 OS=Mus musculus GN=Tie1 PE=1 SV=3 209 313 2.0E-06
sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens GN=STAB2 PE=1 SV=3 221 271 2.0E-06
sp|Q9NY15|STAB1_HUMAN Stabilin-1 OS=Homo sapiens GN=STAB1 PE=1 SV=3 221 268 3.0E-06
sp|Q60438|CREL2_CRIGR Cysteine-rich with EGF-like domain protein 2 OS=Cricetulus griseus GN=CRELD2 PE=2 SV=1 238 417 3.0E-06
sp|P07942|LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens GN=LAMB1 PE=1 SV=2 142 596 4.0E-06
sp|Q7SXF6|CREL2_DANRE Cysteine-rich with EGF-like domain protein 2 OS=Danio rerio GN=creld2 PE=2 SV=2 238 417 5.0E-06
sp|Q02858|TIE2_MOUSE Angiopoietin-1 receptor OS=Mus musculus GN=Tek PE=1 SV=2 211 308 5.0E-06
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 237 494 6.0E-06
sp|Q1LVF0|LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio GN=lamc1 PE=2 SV=2 206 325 6.0E-06
sp|P24348|LET23_CAEEL Receptor tyrosine-protein kinase let-23 OS=Caenorhabditis elegans GN=let-23 PE=1 SV=3 472 625 7.0E-06
sp|Q8JHV6|LAMB4_DANRE Laminin subunit beta-4 OS=Danio rerio GN=lamb4 PE=2 SV=1 199 406 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 684 706 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 43.22 22.92 63.51
Initials Initials knots 29.09 17.34 40.85
Pileal_Stipeal_center Stage I stipe center 68.72 40.07 97.37
Pileal_Stipeal_shell Stage I stipe shell 74.88 44.04 105.73
DIF_stipe_center Stage II stipe center 69.79 41.31 98.28
DIF_stipe_shell Stage II stipe shell 84.25 48.86 119.65
DIF_stipe_skin Stage II stipe skin 68.88 40.76 97.00
DIF_cap_skin Stage II cap skin 72.33 42.36 102.30
DIF_cap_tissue Stage II cap tissue 75.82 44.16 107.49
DIF_gill_tissue Stage II gill tissue 70.06 41.48 98.64
YFB_stipe_center Young fruiting body stipe center 71.06 41.59 100.53
YFB_stipe_shell Young fruiting body stipe shell 57.61 34.35 80.86
YFB_stipe_skin Young fruiting body stipe skin 49.04 29.42 68.65
YFB_cap_skin Young fruiting body cap skin 78.15 45.98 110.31
YFB_cap_tissue Young fruiting body cap tissue 84.43 48.36 120.50
YFB_gill_tissue Young fruiting body gill tissue 66.82 38.39 95.24
YFB_veil Young fruiting body veil 91.32 52.75 129.89

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.108390 no
Casing YFB_stipe_center 0.101862 no
Casing YFB_stipe_shell 0.425099 no
Casing YFB_stipe_skin 0.788856 no
Casing YFB_cap_skin 0.041603 yes
Casing YFB_cap_tissue 0.021322 yes
Casing YFB_gill_tissue 0.168680 no
Casing YFB_veil 0.006387 yes
Casing Initials 0.218316 no
Casing Pileal_Stipeal_center 0.128665 no
Casing Pileal_Stipeal_shell 0.064333 no
Casing DIF_stipe_center 0.110231 no
Casing DIF_stipe_shell 0.019987 yes
Casing DIF_stipe_skin 0.127784 no
Casing DIF_cap_skin 0.084184 no
Casing DIF_cap_tissue 0.054776 no
DIF_gill_tissue YFB_stipe_center 0.979230 no
DIF_gill_tissue YFB_stipe_shell 0.607537 no
DIF_gill_tissue YFB_stipe_skin 0.239956 no
DIF_gill_tissue YFB_cap_skin 0.811691 no
DIF_gill_tissue YFB_cap_tissue 0.640630 no
DIF_gill_tissue YFB_gill_tissue 0.929519 no
DIF_gill_tissue YFB_veil 0.440996 no
YFB_stipe_center YFB_stipe_shell 0.580005 no
YFB_stipe_center YFB_stipe_skin 0.222255 no
YFB_stipe_center YFB_cap_skin 0.844263 no
YFB_stipe_center YFB_cap_tissue 0.683536 no
YFB_stipe_center YFB_gill_tissue 0.906485 no
YFB_stipe_center YFB_veil 0.483886 no
YFB_stipe_shell YFB_stipe_skin 0.686968 no
YFB_stipe_shell YFB_cap_skin 0.352947 no
YFB_stipe_shell YFB_cap_tissue 0.219517 no
YFB_stipe_shell YFB_gill_tissue 0.728137 no
YFB_stipe_shell YFB_veil 0.116571 no
YFB_stipe_skin YFB_cap_skin 0.097447 no
YFB_stipe_skin YFB_cap_tissue 0.051115 no
YFB_stipe_skin YFB_gill_tissue 0.336508 no
YFB_stipe_skin YFB_veil 0.020260 yes
YFB_cap_skin YFB_cap_tissue 0.882336 no
YFB_cap_skin YFB_gill_tissue 0.706008 no
YFB_cap_skin YFB_veil 0.708521 no
YFB_cap_tissue YFB_gill_tissue 0.532315 no
YFB_cap_tissue YFB_veil 0.879194 no
YFB_gill_tissue YFB_veil 0.347481 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.006742 yes
Initials YFB_stipe_skin 0.053565 no
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.972008 no
Pileal_Stipeal_center YFB_stipe_center 0.953764 no
Pileal_Stipeal_center YFB_stipe_shell 0.660130 no
Pileal_Stipeal_center YFB_stipe_skin 0.278683 no
Pileal_Stipeal_center YFB_cap_skin 0.773629 no
Pileal_Stipeal_center YFB_cap_tissue 0.599481 no
Pileal_Stipeal_center YFB_gill_tissue 0.960010 no
Pileal_Stipeal_center YFB_veil 0.405897 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.862735 no
Pileal_Stipeal_center DIF_stipe_center 0.976879 no
Pileal_Stipeal_center DIF_stipe_shell 0.596083 no
Pileal_Stipeal_center DIF_stipe_skin 0.995604 no
Pileal_Stipeal_center DIF_cap_skin 0.922461 no
Pileal_Stipeal_center DIF_cap_tissue 0.838617 no
Pileal_Stipeal_shell DIF_gill_tissue 0.894880 no
Pileal_Stipeal_shell YFB_stipe_center 0.924757 no
Pileal_Stipeal_shell YFB_stipe_shell 0.456598 no
Pileal_Stipeal_shell YFB_stipe_skin 0.142501 no
Pileal_Stipeal_shell YFB_cap_skin 0.936701 no
Pileal_Stipeal_shell YFB_cap_tissue 0.799653 no
Pileal_Stipeal_shell YFB_gill_tissue 0.807721 no
Pileal_Stipeal_shell YFB_veil 0.611662 no
Pileal_Stipeal_shell DIF_stipe_center 0.888589 no
Pileal_Stipeal_shell DIF_stipe_shell 0.801561 no
Pileal_Stipeal_shell DIF_stipe_skin 0.866900 no
Pileal_Stipeal_shell DIF_cap_skin 0.948976 no
Pileal_Stipeal_shell DIF_cap_tissue 0.981443 no
DIF_stipe_center DIF_gill_tissue 0.993923 no
DIF_stipe_center YFB_stipe_center 0.974759 no
DIF_stipe_center YFB_stipe_shell 0.619162 no
DIF_stipe_center YFB_stipe_skin 0.244805 no
DIF_stipe_center YFB_cap_skin 0.805731 no
DIF_stipe_center YFB_cap_tissue 0.633398 no
DIF_stipe_center YFB_gill_tissue 0.936865 no
DIF_stipe_center YFB_veil 0.434934 no
DIF_stipe_center DIF_stipe_shell 0.632529 no
DIF_stipe_center DIF_stipe_skin 0.980154 no
DIF_stipe_center DIF_cap_skin 0.947165 no
DIF_stipe_center DIF_cap_tissue 0.867943 no
DIF_stipe_shell DIF_gill_tissue 0.634282 no
DIF_stipe_shell YFB_stipe_center 0.682222 no
DIF_stipe_shell YFB_stipe_shell 0.212824 no
DIF_stipe_shell YFB_stipe_skin 0.049882 yes
DIF_stipe_shell YFB_cap_skin 0.883329 no
DIF_stipe_shell YFB_cap_tissue 0.996657 no
DIF_stipe_shell YFB_gill_tissue 0.530314 no
DIF_stipe_shell YFB_veil 0.873350 no
DIF_stipe_shell DIF_stipe_skin 0.599588 no
DIF_stipe_shell DIF_cap_skin 0.715156 no
DIF_stipe_shell DIF_cap_tissue 0.824701 no
DIF_stipe_skin DIF_gill_tissue 0.975790 no
DIF_stipe_skin YFB_stipe_center 0.957106 no
DIF_stipe_skin YFB_stipe_shell 0.652111 no
DIF_stipe_skin YFB_stipe_skin 0.269163 no
DIF_stipe_skin YFB_cap_skin 0.776644 no
DIF_stipe_skin YFB_cap_tissue 0.601269 no
DIF_stipe_skin YFB_gill_tissue 0.957035 no
DIF_stipe_skin YFB_veil 0.402761 no
DIF_stipe_skin DIF_cap_skin 0.926793 no
DIF_stipe_skin DIF_cap_tissue 0.841029 no
DIF_cap_skin DIF_gill_tissue 0.953276 no
DIF_cap_skin YFB_stipe_center 0.975528 no
DIF_cap_skin YFB_stipe_shell 0.533876 no
DIF_cap_skin YFB_stipe_skin 0.193015 no
DIF_cap_skin YFB_cap_skin 0.877646 no
DIF_cap_skin YFB_cap_tissue 0.720576 no
DIF_cap_skin YFB_gill_tissue 0.875427 no
DIF_cap_skin YFB_veil 0.520742 no
DIF_cap_skin DIF_cap_tissue 0.929662 no
DIF_cap_tissue DIF_gill_tissue 0.871441 no
DIF_cap_tissue YFB_stipe_center 0.904349 no
DIF_cap_tissue YFB_stipe_shell 0.420424 no
DIF_cap_tissue YFB_stipe_skin 0.123509 no
DIF_cap_tissue YFB_cap_skin 0.956908 no
DIF_cap_tissue YFB_cap_tissue 0.824341 no
DIF_cap_tissue YFB_gill_tissue 0.779075 no
DIF_cap_tissue YFB_veil 0.638440 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|063390
MITILARALIIGFFAAHSAAQSNKTVVCVAGQCVEGTTNTTLGARLTASDTSLSLHLLPGTYSSTTSPQLLHNLL
TSSSASLSPSTGFENASKSFNPTDLPFELDLSPGITIYDGLLYSGQSLYGGFPDKPPPDQKSSQKDITLGSLAIS
QNVFIVIGGSSDNDDRVVVWNSIPDIRQLPSSASLPASSSSSSTATLRIIDVGSSTCNPQCSGNSICSPTTGRCV
CAPGFTGTSCESCSPGLFGPTCQACPDGCDQCDEGISGSGICLKKTVTGKPGGCGCVNGQCGSNGQCACNAGWKD
GDDGTKCSKCQDGFFLTSTGDCQVCQLGCSRCADTSGTCVQCNAGFAIDTADNTKCNLVRQPTSTGQQCPDGSFS
NGDTCAACASDCETCTGATSNDCATCASGRFKLNGNCVTTNSDGTCVGATGMIANNIKSECDACPSKCTSCAYSS
FSVASTIDQSQCTGCLPGFFLSQGKCVESCPAGTFLSPQDNLNCIPCDSSCGTCIDSADFCLTCSTAGRLASDGK
CVSSCPSNTFPSNSTSCGTCHGDCASCSGPQFNQCTSCPPNRPVLKDGRCLSTCAKGEFFDKTSSSCTGCDSNCE
TCSASGPDKCLSCTSGEVLRSGKCVKTDGGCQTLAGFGVCLEELVIIVGQNHTTNATTPAQPKPSISGIADPTVV
RVENKLEGWQIALMVLGVVFILCILIILWRWRARRKRKERTQAWAARRKVLGNMPWWKRMFASRWRDRSSRMEKE
GRLPQYRDEVSRSARADSTVDGFIDAYADARSSRSDVGSRSLFSEVTGSRRKAPEPRVPVRSSVSTVATSQKSWR
ISETEAARYARSIREQPGPAAGEESLSGLPPFLATEPFERNPFRRRA*
Coding >AgabiH97|063390
ATGATTACAATCTTGGCTAGAGCTTTAATTATTGGGTTTTTCGCTGCTCATTCTGCTGCTCAGTCGAATAAAACC
GTTGTATGCGTTGCTGGTCAATGCGTAGAAGGTACAACTAATACTACTCTCGGTGCCCGATTAACCGCGTCCGAT
ACATCTTTATCCCTACATCTCCTACCAGGGACTTATTCATCCACGACAAGCCCACAACTCCTCCATAACCTTCTC
ACATCTTCCAGTGCATCCCTCTCACCATCTACCGGCTTCGAAAATGCATCCAAATCTTTCAACCCGACTGATCTT
CCCTTCGAATTGGATTTATCTCCTGGAATAACTATTTATGATGGTTTACTCTACTCTGGTCAATCATTATATGGT
GGATTTCCGGATAAACCCCCGCCGGATCAAAAGAGTTCTCAAAAAGATATCACGCTTGGCTCTTTGGCGATTTCG
CAGAACGTGTTTATTGTGATTGGTGGATCGAGTGATAATGATGATAGAGTTGTTGTTTGGAATTCCATCCCCGAT
ATACGACAATTACCCTCCTCAGCATCATTACCAGCTTCTTCGTCGTCAAGTTCGACTGCGACCCTTCGAATCATT
GACGTCGGTTCATCAACATGTAATCCTCAATGTTCTGGTAATAGTATTTGTTCACCGACAACGGGTCGATGCGTC
TGCGCTCCAGGATTCACAGGAACATCATGTGAATCGTGTTCTCCTGGACTTTTTGGACCTACATGTCAAGCATGT
CCGGATGGTTGTGATCAATGCGATGAAGGGATTTCAGGATCTGGGATCTGTTTGAAGAAAACTGTTACTGGCAAA
CCTGGAGGTTGTGGGTGTGTGAATGGACAATGTGGGAGTAATGGGCAGTGCGCTTGTAATGCCGGGTGGAAAGAT
GGTGATGATGGGACGAAATGTTCGAAATGCCAAGATGGCTTCTTCTTGACTTCGACTGGTGATTGTCAAGTATGC
CAACTCGGGTGCTCGCGTTGTGCGGACACGTCGGGGACTTGCGTTCAATGCAATGCCGGCTTTGCTATAGATACC
GCAGATAACACGAAATGCAACCTCGTACGGCAACCTACTTCGACAGGTCAACAATGCCCGGATGGAAGTTTTAGC
AATGGTGACACTTGTGCAGCATGCGCTAGCGATTGTGAAACTTGTACCGGTGCCACGTCAAATGATTGTGCCACT
TGCGCATCTGGGAGATTCAAGTTGAATGGGAATTGCGTTACGACAAATAGCGATGGAACTTGTGTTGGTGCTACT
GGGATGATTGCGAATAATATCAAGAGTGAATGTGATGCTTGTCCCTCGAAATGCACTTCTTGTGCATATTCAAGT
TTCAGTGTTGCTTCGACCATTGACCAGTCACAATGCACAGGCTGTTTACCCGGTTTCTTTCTGTCGCAAGGAAAA
TGTGTTGAAAGTTGTCCGGCAGGGACTTTCTTGTCGCCTCAAGACAATCTCAACTGTATTCCTTGCGACTCTTCA
TGTGGTACTTGCATTGATTCGGCCGATTTCTGCCTCACTTGTAGCACAGCCGGTCGACTCGCTTCCGATGGCAAA
TGCGTTTCTTCTTGTCCCTCCAACACATTCCCTTCCAATTCGACTTCTTGTGGAACATGTCACGGCGACTGTGCT
TCTTGTTCAGGCCCTCAATTCAACCAATGCACGTCATGTCCGCCCAATAGACCGGTACTCAAGGATGGCAGATGT
TTGTCCACATGTGCTAAAGGGGAATTTTTCGACAAGACTTCGAGTAGTTGCACAGGCTGTGACAGCAACTGCGAA
ACTTGTTCCGCATCGGGTCCTGACAAGTGCTTGAGTTGCACATCGGGCGAAGTGTTACGGTCGGGAAAATGCGTT
AAGACTGATGGAGGATGTCAGACATTGGCAGGCTTCGGGGTATGTTTAGAAGAATTGGTCATAATTGTTGGTCAG
AATCACACCACGAATGCGACAACACCGGCTCAACCTAAGCCGAGCATTTCCGGAATCGCTGATCCTACGGTAGTC
AGAGTCGAAAACAAACTGGAGGGATGGCAAATTGCTTTAATGGTATTGGGAGTTGTTTTCATTCTGTGCATTCTT
ATTATTCTATGGCGATGGAGAGCGAGGAGGAAGAGAAAGGAAAGGACACAAGCATGGGCTGCGCGGCGGAAAGTT
CTCGGAAATATGCCGTGGTGGAAGCGAATGTTTGCTTCTCGCTGGAGAGATCGTAGTTCAAGGATGGAAAAAGAG
GGGAGGCTGCCTCAGTACAGAGACGAGGTGTCGCGATCGGCGCGCGCAGACTCGACGGTGGACGGATTCATCGAT
GCCTATGCCGACGCACGTTCAAGCCGGTCGGATGTCGGGAGCCGATCACTTTTCTCCGAGGTTACGGGGTCACGG
AGGAAGGCACCGGAGCCACGCGTCCCTGTTCGGTCAAGTGTTTCCACGGTAGCTACGAGCCAGAAGAGCTGGAGG
ATAAGCGAGACAGAGGCTGCGAGATATGCGAGGAGTATTCGTGAACAACCTGGGCCAGCAGCTGGGGAGGAAAGC
CTGTCAGGTTTACCGCCGTTTCTTGCGACGGAGCCGTTTGAGCGCAATCCGTTCCGGCGTCGGGCATGA
Transcript >AgabiH97|063390
ATGATTACAATCTTGGCTAGAGCTTTAATTATTGGGTTTTTCGCTGCTCATTCTGCTGCTCAGTCGAATAAAACC
GTTGTATGCGTTGCTGGTCAATGCGTAGAAGGTACAACTAATACTACTCTCGGTGCCCGATTAACCGCGTCCGAT
ACATCTTTATCCCTACATCTCCTACCAGGGACTTATTCATCCACGACAAGCCCACAACTCCTCCATAACCTTCTC
ACATCTTCCAGTGCATCCCTCTCACCATCTACCGGCTTCGAAAATGCATCCAAATCTTTCAACCCGACTGATCTT
CCCTTCGAATTGGATTTATCTCCTGGAATAACTATTTATGATGGTTTACTCTACTCTGGTCAATCATTATATGGT
GGATTTCCGGATAAACCCCCGCCGGATCAAAAGAGTTCTCAAAAAGATATCACGCTTGGCTCTTTGGCGATTTCG
CAGAACGTGTTTATTGTGATTGGTGGATCGAGTGATAATGATGATAGAGTTGTTGTTTGGAATTCCATCCCCGAT
ATACGACAATTACCCTCCTCAGCATCATTACCAGCTTCTTCGTCGTCAAGTTCGACTGCGACCCTTCGAATCATT
GACGTCGGTTCATCAACATGTAATCCTCAATGTTCTGGTAATAGTATTTGTTCACCGACAACGGGTCGATGCGTC
TGCGCTCCAGGATTCACAGGAACATCATGTGAATCGTGTTCTCCTGGACTTTTTGGACCTACATGTCAAGCATGT
CCGGATGGTTGTGATCAATGCGATGAAGGGATTTCAGGATCTGGGATCTGTTTGAAGAAAACTGTTACTGGCAAA
CCTGGAGGTTGTGGGTGTGTGAATGGACAATGTGGGAGTAATGGGCAGTGCGCTTGTAATGCCGGGTGGAAAGAT
GGTGATGATGGGACGAAATGTTCGAAATGCCAAGATGGCTTCTTCTTGACTTCGACTGGTGATTGTCAAGTATGC
CAACTCGGGTGCTCGCGTTGTGCGGACACGTCGGGGACTTGCGTTCAATGCAATGCCGGCTTTGCTATAGATACC
GCAGATAACACGAAATGCAACCTCGTACGGCAACCTACTTCGACAGGTCAACAATGCCCGGATGGAAGTTTTAGC
AATGGTGACACTTGTGCAGCATGCGCTAGCGATTGTGAAACTTGTACCGGTGCCACGTCAAATGATTGTGCCACT
TGCGCATCTGGGAGATTCAAGTTGAATGGGAATTGCGTTACGACAAATAGCGATGGAACTTGTGTTGGTGCTACT
GGGATGATTGCGAATAATATCAAGAGTGAATGTGATGCTTGTCCCTCGAAATGCACTTCTTGTGCATATTCAAGT
TTCAGTGTTGCTTCGACCATTGACCAGTCACAATGCACAGGCTGTTTACCCGGTTTCTTTCTGTCGCAAGGAAAA
TGTGTTGAAAGTTGTCCGGCAGGGACTTTCTTGTCGCCTCAAGACAATCTCAACTGTATTCCTTGCGACTCTTCA
TGTGGTACTTGCATTGATTCGGCCGATTTCTGCCTCACTTGTAGCACAGCCGGTCGACTCGCTTCCGATGGCAAA
TGCGTTTCTTCTTGTCCCTCCAACACATTCCCTTCCAATTCGACTTCTTGTGGAACATGTCACGGCGACTGTGCT
TCTTGTTCAGGCCCTCAATTCAACCAATGCACGTCATGTCCGCCCAATAGACCGGTACTCAAGGATGGCAGATGT
TTGTCCACATGTGCTAAAGGGGAATTTTTCGACAAGACTTCGAGTAGTTGCACAGGCTGTGACAGCAACTGCGAA
ACTTGTTCCGCATCGGGTCCTGACAAGTGCTTGAGTTGCACATCGGGCGAAGTGTTACGGTCGGGAAAATGCGTT
AAGACTGATGGAGGATGTCAGACATTGGCAGGCTTCGGGGTATGTTTAGAAGAATTGGTCATAATTGTTGGTCAG
AATCACACCACGAATGCGACAACACCGGCTCAACCTAAGCCGAGCATTTCCGGAATCGCTGATCCTACGGTAGTC
AGAGTCGAAAACAAACTGGAGGGATGGCAAATTGCTTTAATGGTATTGGGAGTTGTTTTCATTCTGTGCATTCTT
ATTATTCTATGGCGATGGAGAGCGAGGAGGAAGAGAAAGGAAAGGACACAAGCATGGGCTGCGCGGCGGAAAGTT
CTCGGAAATATGCCGTGGTGGAAGCGAATGTTTGCTTCTCGCTGGAGAGATCGTAGTTCAAGGATGGAAAAAGAG
GGGAGGCTGCCTCAGTACAGAGACGAGGTGTCGCGATCGGCGCGCGCAGACTCGACGGTGGACGGATTCATCGAT
GCCTATGCCGACGCACGTTCAAGCCGGTCGGATGTCGGGAGCCGATCACTTTTCTCCGAGGTTACGGGGTCACGG
AGGAAGGCACCGGAGCCACGCGTCCCTGTTCGGTCAAGTGTTTCCACGGTAGCTACGAGCCAGAAGAGCTGGAGG
ATAAGCGAGACAGAGGCTGCGAGATATGCGAGGAGTATTCGTGAACAACCTGGGCCAGCAGCTGGGGAGGAAAGC
CTGTCAGGTTTACCGCCGTTTCTTGCGACGGAGCCGTTTGAGCGCAATCCGTTCCGGCGTCGGGCATGA
Gene >AgabiH97|063390
ATGATTACAATCTTGGCTAGAGCTTTAATTATTGGGTTTTTCGCTGCTCATTCTGGTGAGTTTCTCTGTCCTTTC
AGGATGACATTGAAAACTAATGACAATGTGTGTAGCTGCTCAGTCGAATAAAACCGTTGTATGCGTTGCTGGTCA
ATGCGTAGAAGGTACAACTAATACTACTCGTGCGTTTTCTGCGTTTCTCTTTGATGTTTTGCTTAACCATTTGTT
ATTCGATAGTCGGTGCCCGATTAACCGCGTCCGATACATCTTTATCCCTACATCTCCTACCAGGGACTTATTCAT
CCACGACAAGCCCACAACTCCTCCATAACCTTCTCACATCTTCCAGTGCATCCCTCTCACCATCTACCGGCTTCG
AAAATGCATCCAAATCTTTCAACCCGACTGATCTTCCCTTCGAATTGGATTTATCTCCTGGAATAACTATTTATG
ATGGTTTACTCTACTCTGGTCAATCATTATATGGTGGATTTCCGGATAAACCCCCGCCGGATCAAAAGAGTTCTC
AAAAAGATATCACGCTTGGCTCTTTGGCGATTTCGCAGAACGTGTTTATTGTGATTGGTGGATCGAGTGATAATG
ATGATAGAGTTGTTGTTTGGAATTCCATCCCCGATATACGACAATTACCCTCCTCAGCATCATTACCAGCTTCTT
CGTCGTCAAGTTCGACTGCGACCCTTCGAATCATTGACGTCGGTTCATCAACATGTAATCCTCAATGTTCTGGTA
ATAGTATTTGTTCACCGACAACGGGTCGATGCGTCTGCGCTCCAGGATTCACAGGAACATCATGTGAATCGTGTT
CTCCTGGACTTTTTGGACCTACATGTCAAGCATGTCCGGATGGTTGTGATCAATGCGATGAAGGGATTTCAGGAT
CTGGGATCTGTTTGAAGAAAACTGTTACTGGCAAACCTGGAGGTTGTGGGTGTGTGAATGGACAATGTGGGAGTA
ATGGGCAGTGCGCTTGTAATGCCGGGTGGAAAGATGGTGATGATGGGACGAAATGTTCGAAATGCCAAGATGGCT
TCTTCTTGACTTCGACTGGTGATTGTCAAGGTATAGTTACGCTCAAATATGTCTTCCCTTGGTTTCATTAATTTT
TATTGTTAGTATGCCAACTCGGGTGCTCGCGTTGTGCGGACACGTCGGGGACTTGCGTTCAATGCAATGCCGGCT
TTGCTATAGATACCGCAGATAACACGAAATGCAACCTCGTACGGCAACCTACTTCGACAGGTCAACAATGCCCGG
ATGGAAGTTTTAGCAATGGTGACACTTGTGCAGCATGCGCTAGCGATTGTGAAACTTGTACCGGTGCCACGTCAA
ATGATTGTGCCACTTGCGCATCTGGGAGATTCAAGTTGAATGGGAATTGCGTTACGACAAATAGCGATGGAACTT
GTGTTGGTGCTACTGGGATGATTGCGAATAATATCAAGAGTGAATGTGATGGTGAGTAATTGGGATTCATCTTAT
AAAGTAGTCAGCGCAAACTGACGTTGGTATAGCTTGTCCCTCGAAATGCACTTCTTGTGCATATTCAAGTTTCAG
TGTTGCTTCGACCATTGACCAGTCACAATGCACAGGCTGTTTACCCGGTTTCTTTCTGTCGCAAGGAAAATGTGT
TGAAAGTTGTCCGGCAGGGACTTTCTTGTCGCCTCAAGACAATCTCAACTGTATTCGTACGTATTTTTATGCTTG
TTGGAATACACAAACTTACACATTTCTAATATTACCAGCTTGCGACTCTTCATGTGGTACTTGCATTGATTCGGC
CGATTTCTGCCTCACTTGTAGCACAGCCGGTCGACTCGCTTCCGATGGCAAATGCGTTTCTTCTTGTCCCTCCAA
CACATTCCCTTCCAATTCGACTTCTTGTGGAACATGTCACGGCGACTGTGCTTCTTGTTCAGGCCCTCAATTCAA
CCAATGCACGTCATGTCCGCCCAATAGACCGGTACTCAAGGATGGCAGATGTTTGTCCACATGTGCTAAAGGGGA
ATTTTTCGACAAGACTTCGAGTAGTTGCACAGGCTGTGACAGCAACTGCGAAACTTGTTCCGCATCGGGTCCTGA
CAAGTGCTTGAGTTGCACATCGGGCGAAGTGTTACGGTCGGGAAAATGCGTTAAGACTGATGGAGGATGTCAGAC
ATTGGCAGGCTTCGGGGTATGTTTAGAAGAATTGGTCATAATTGTTGGTCAGAATCACACCACGAATGCGACAAC
ACCGGCTCAACCTAAGCCGAGCATTTCCGGAATCGCTGATCCTACGGTAGTCAGAGTCGAAAACAAACTGGAGGG
ATGGCAAATTGCTTTAATGGTATTGGGAGTTGTTTTCATTCTGTGCATTCTTATTATTCTATGGCGATGGAGAGC
GAGGAGGAAGAGAAAGGAAAGGACACAAGCATGGGCTGCGCGGCGGAAAGTTCTCGGAAATATGCCGTGGTGGAA
GCGAATGTTTGCTTCTCGCTGGAGAGATCGTAGTTCAAGGATGGAAAAAGAGGGGAGGCTGCCTCAGTACAGAGA
CGAGGTGTCGCGATCGGCGCGCGCAGACTCGACGGTGGACGGATTCATCGATGCCTATGCCGACGCACGTTCAAG
CCGGTCGGATGTCGGGAGCCGATCACTTTTCTCCGAGGTTACGGGGTCACGGAGGAAGGCACCGGAGCCACGCGT
CCCTGTTCGGTCAAGTGTTTCCACGGTAGCTACGAGCCAGAAGAGCTGGAGGATAAGCGAGACAGAGGCTGCGAG
ATATGCGAGGAGTATTCGTGAACAACCTGGGCCAGCAGCTGGGGAGGAAAGCCTGTCAGGTTTACCGCCGTTTCT
TGCGACGGAGCCGTTTGAGCGCAATCCGTTCCGGCGTCGGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail