Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|063250
Gene name
Locationscaffold_3:2539660..2541170
Strand+
Gene length (bp)1510
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 3.3E-28 92 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 22 246 3.0E-16
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 27 271 1.0E-13
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 80 239 2.0E-12
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 30 271 2.0E-12
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 30 271 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 22 246 3.0E-16
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 27 271 1.0E-13
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 80 239 2.0E-12
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 30 271 2.0E-12
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 30 271 2.0E-12
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 80 239 3.0E-12
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 80 239 3.0E-12
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 80 279 4.0E-12
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 80 279 4.0E-12
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 80 239 8.0E-12
sp|O42815|FAEA_ASPTU Feruloyl esterase A OS=Aspergillus tubingensis GN=faeA PE=3 SV=1 80 239 5.0E-11
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 58 239 1.0E-10
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 58 239 3.0E-10
sp|Q948R1|PLA11_ARATH Phospholipase A(1) DAD1, chloroplastic OS=Arabidopsis thaliana GN=DAD1 PE=1 SV=1 90 235 4.0E-08
sp|Q941F1|PLA15_ARATH Phospholipase A1-Igamma1, chloroplastic OS=Arabidopsis thaliana GN=At1g06800 PE=1 SV=2 90 235 9.0E-08
sp|A2ZW16|PLA1_ORYSJ Phospholipase A1-II 1 OS=Oryza sativa subsp. japonica GN=Os01g0651100 PE=3 SV=2 90 246 1.0E-07
sp|A2WT95|PLA1_ORYSI Phospholipase A1-II 1 OS=Oryza sativa subsp. indica GN=OsI_03083 PE=3 SV=2 90 246 1.0E-07
sp|Q3EBR6|PLA16_ARATH Phospholipase A1-Igamma2, chloroplastic OS=Arabidopsis thaliana GN=At2g30550 PE=1 SV=2 128 235 4.0E-07
sp|Q9XTR8|LIP1_CAEEL Lipase ZK262.3 OS=Caenorhabditis elegans GN=ZK262.3 PE=1 SV=1 152 232 6.0E-07
sp|B8A8C9|PLA5_ORYSI Phospholipase A1-II 5 OS=Oryza sativa subsp. indica GN=OsI_03470 PE=3 SV=1 137 246 3.0E-06
sp|Q5NAI4|PLA5_ORYSJ Phospholipase A1-II 5 OS=Oryza sativa subsp. japonica GN=Os01g0710700 PE=2 SV=1 137 246 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2117 0.1415 0.8951 0.1915 0.2148 0.0752 0.1228 0.3185 0.0586 0.0482

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 38.25 20.41 56.09
Initials Initials knots 24.25 12.51 35.99
Pileal_Stipeal_center Stage I stipe center 13.23 6.26 20.20
Pileal_Stipeal_shell Stage I stipe shell 22.31 11.28 33.34
DIF_stipe_center Stage II stipe center 16.46 8.05 24.87
DIF_stipe_shell Stage II stipe shell 11.41 5.26 17.56
DIF_stipe_skin Stage II stipe skin 12.98 6.08 19.87
DIF_cap_skin Stage II cap skin 15.49 7.49 23.49
DIF_cap_tissue Stage II cap tissue 17.21 8.45 25.97
DIF_gill_tissue Stage II gill tissue 17.78 8.72 26.84
YFB_stipe_center Young fruiting body stipe center 14.50 6.98 22.03
YFB_stipe_shell Young fruiting body stipe shell 12.92 6.08 19.76
YFB_stipe_skin Young fruiting body stipe skin 10.85 5.01 16.69
YFB_cap_skin Young fruiting body cap skin 14.76 7.10 22.42
YFB_cap_tissue Young fruiting body cap tissue 9.12 4.03 14.22
YFB_gill_tissue Young fruiting body gill tissue 11.54 5.30 17.79
YFB_veil Young fruiting body veil 15.72 7.60 23.85

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.009773 yes
Casing YFB_stipe_center 0.002525 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.001625 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.004928 yes
Casing Initials 0.185461 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.108700 no
Casing DIF_stipe_center 0.003765 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.002951 yes
Casing DIF_cap_tissue 0.010412 yes
DIF_gill_tissue YFB_stipe_center 0.692364 no
DIF_gill_tissue YFB_stipe_shell 0.483634 no
DIF_gill_tissue YFB_stipe_skin 0.201274 no
DIF_gill_tissue YFB_cap_skin 0.727313 no
DIF_gill_tissue YFB_cap_tissue 0.075556 no
DIF_gill_tissue YFB_gill_tissue 0.288589 no
DIF_gill_tissue YFB_veil 0.840941 no
YFB_stipe_center YFB_stipe_shell 0.855644 no
YFB_stipe_center YFB_stipe_skin 0.543190 no
YFB_stipe_center YFB_cap_skin 0.980154 no
YFB_stipe_center YFB_cap_tissue 0.274355 no
YFB_stipe_center YFB_gill_tissue 0.666701 no
YFB_stipe_center YFB_veil 0.904414 no
YFB_stipe_shell YFB_stipe_skin 0.765142 no
YFB_stipe_shell YFB_cap_skin 0.829855 no
YFB_stipe_shell YFB_cap_tissue 0.476094 no
YFB_stipe_shell YFB_gill_tissue 0.865539 no
YFB_stipe_shell YFB_veil 0.728193 no
YFB_stipe_skin YFB_cap_skin 0.510874 no
YFB_stipe_skin YFB_cap_tissue 0.778597 no
YFB_stipe_skin YFB_gill_tissue 0.931458 no
YFB_stipe_skin YFB_veil 0.400535 no
YFB_cap_skin YFB_cap_tissue 0.253365 no
YFB_cap_skin YFB_gill_tissue 0.633925 no
YFB_cap_skin YFB_veil 0.927467 no
YFB_cap_tissue YFB_gill_tissue 0.670413 no
YFB_cap_tissue YFB_veil 0.173592 no
YFB_gill_tissue YFB_veil 0.513594 no
Initials DIF_gill_tissue 0.450128 no
Initials YFB_stipe_center 0.160771 no
Initials YFB_stipe_shell 0.082277 no
Initials YFB_stipe_skin 0.016949 yes
Initials YFB_cap_skin 0.179329 no
Initials YFB_cap_tissue 0.004160 yes
Initials YFB_gill_tissue 0.033674 yes
Initials YFB_veil 0.257979 no
Initials Pileal_Stipeal_center 0.078769 no
Initials Pileal_Stipeal_shell 0.893375 no
Initials DIF_stipe_center 0.307860 no
Initials DIF_stipe_shell 0.029890 yes
Initials DIF_stipe_skin 0.069013 no
Initials DIF_cap_skin 0.237769 no
Initials DIF_cap_tissue 0.389694 no
Pileal_Stipeal_center DIF_gill_tissue 0.503070 no
Pileal_Stipeal_center YFB_stipe_center 0.888375 no
Pileal_Stipeal_center YFB_stipe_shell 0.973674 no
Pileal_Stipeal_center YFB_stipe_skin 0.716053 no
Pileal_Stipeal_center YFB_cap_skin 0.863231 no
Pileal_Stipeal_center YFB_cap_tissue 0.413717 no
Pileal_Stipeal_center YFB_gill_tissue 0.824191 no
Pileal_Stipeal_center YFB_veil 0.763818 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.156383 no
Pileal_Stipeal_center DIF_stipe_center 0.658924 no
Pileal_Stipeal_center DIF_stipe_shell 0.805758 no
Pileal_Stipeal_center DIF_stipe_skin 0.977610 no
Pileal_Stipeal_center DIF_cap_skin 0.784866 no
Pileal_Stipeal_center DIF_cap_tissue 0.570717 no
Pileal_Stipeal_shell DIF_gill_tissue 0.630367 no
Pileal_Stipeal_shell YFB_stipe_center 0.275156 no
Pileal_Stipeal_shell YFB_stipe_shell 0.142370 no
Pileal_Stipeal_shell YFB_stipe_skin 0.035076 yes
Pileal_Stipeal_shell YFB_cap_skin 0.304877 no
Pileal_Stipeal_shell YFB_cap_tissue 0.011350 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.062038 no
Pileal_Stipeal_shell YFB_veil 0.416288 no
Pileal_Stipeal_shell DIF_stipe_center 0.481222 no
Pileal_Stipeal_shell DIF_stipe_shell 0.059906 no
Pileal_Stipeal_shell DIF_stipe_skin 0.130677 no
Pileal_Stipeal_shell DIF_cap_skin 0.384267 no
Pileal_Stipeal_shell DIF_cap_tissue 0.569256 no
DIF_stipe_center DIF_gill_tissue 0.901094 no
DIF_stipe_center YFB_stipe_center 0.833661 no
DIF_stipe_center YFB_stipe_shell 0.629934 no
DIF_stipe_center YFB_stipe_skin 0.310583 no
DIF_stipe_center YFB_cap_skin 0.861155 no
DIF_stipe_center YFB_cap_tissue 0.121262 no
DIF_stipe_center YFB_gill_tissue 0.416437 no
DIF_stipe_center YFB_veil 0.948481 no
DIF_stipe_center DIF_stipe_shell 0.395131 no
DIF_stipe_center DIF_stipe_skin 0.618536 no
DIF_stipe_center DIF_cap_skin 0.929458 no
DIF_stipe_center DIF_cap_tissue 0.946823 no
DIF_stipe_shell DIF_gill_tissue 0.268668 no
DIF_stipe_shell YFB_stipe_center 0.642259 no
DIF_stipe_shell YFB_stipe_shell 0.848329 no
DIF_stipe_shell YFB_stipe_skin 0.944917 no
DIF_stipe_shell YFB_cap_skin 0.607681 no
DIF_stipe_shell YFB_cap_tissue 0.693869 no
DIF_stipe_shell YFB_gill_tissue 0.987103 no
DIF_stipe_shell YFB_veil 0.493659 no
DIF_stipe_shell DIF_stipe_skin 0.836185 no
DIF_stipe_shell DIF_cap_skin 0.515480 no
DIF_stipe_shell DIF_cap_tissue 0.318962 no
DIF_stipe_skin DIF_gill_tissue 0.463453 no
DIF_stipe_skin YFB_stipe_center 0.860905 no
DIF_stipe_skin YFB_stipe_shell 0.995010 no
DIF_stipe_skin YFB_stipe_skin 0.751088 no
DIF_stipe_skin YFB_cap_skin 0.831265 no
DIF_stipe_skin YFB_cap_tissue 0.449219 no
DIF_stipe_skin YFB_gill_tissue 0.854411 no
DIF_stipe_skin YFB_veil 0.728260 no
DIF_stipe_skin DIF_cap_skin 0.750027 no
DIF_stipe_skin DIF_cap_tissue 0.526948 no
DIF_cap_skin DIF_gill_tissue 0.810148 no
DIF_cap_skin YFB_stipe_center 0.925237 no
DIF_cap_skin YFB_stipe_shell 0.752248 no
DIF_cap_skin YFB_stipe_skin 0.431613 no
DIF_cap_skin YFB_cap_skin 0.946641 no
DIF_cap_skin YFB_cap_tissue 0.195682 no
DIF_cap_skin YFB_gill_tissue 0.543305 no
DIF_cap_skin YFB_veil 0.983554 no
DIF_cap_skin DIF_cap_tissue 0.864614 no
DIF_cap_tissue DIF_gill_tissue 0.960254 no
DIF_cap_tissue YFB_stipe_center 0.753919 no
DIF_cap_tissue YFB_stipe_shell 0.540966 no
DIF_cap_tissue YFB_stipe_skin 0.241032 no
DIF_cap_tissue YFB_cap_skin 0.784083 no
DIF_cap_tissue YFB_cap_tissue 0.087586 no
DIF_cap_tissue YFB_gill_tissue 0.339657 no
DIF_cap_tissue YFB_veil 0.886337 no

Orthologs

Orthofinder run ID1
Orthogroup106
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|000340
Agaricus bisporus var bisporus H39 AgabiH39|001820
Agaricus bisporus var bisporus H39 AgabiH39|001830
Agaricus bisporus var bisporus H39 AgabiH39|063250
Agaricus bisporus var bisporus H39 AgabiH39|090410
Agaricus bisporus var bisporus H97 AgabiH97|000340
Agaricus bisporus var bisporus H97 AgabiH97|001820
Agaricus bisporus var bisporus H97 AgabiH97|001830
Agaricus bisporus var bisporus H97 AgabiH97|063250 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|090410
Rhodonia placenta FPRL280 RhoplFPRL280|214_10
Rhodonia placenta FPRL280 RhoplFPRL280|283_4
Rhodonia placenta FPRL280 RhoplFPRL280|551_2
Rhodonia placenta FPRL280 RhoplFPRL280|551_3

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|063250
MVFGLRTGDASHHRTEDNGYSRCEYISDYIASFRPYTNFAAVAGCPPATVLAWNCAKCNANPTFTPVAAGGNGAS
VQFWYVGYDANLASVIVGFQGTDADKILPILTDADFFLTTLDSGLFPGLSSDIKTHNGFNDAQMASASAVLSAVN
TAMSRFGARRVTVTGHSLGGAIATISAVHLKLHLPSTTTFKVVTYGCPRVGNQAFANYFNSRFPGANSRINNQDD
IVPIVPGRFLGFDHVEGEIHILNNNGWVSCPGQDNEDGDCTIGYVPNIFAGDTGDHSGPYDGIRMGCS*
Coding >AgabiH97|063250
ATGGTCTTTGGACTTCGCACCGGGGATGCTTCGCATCACCGAACAGAGGACAACGGCTACTCTCGATGTGAATAT
ATAAGCGACTATATCGCCTCGTTCAGGCCTTACACCAATTTCGCTGCTGTCGCTGGATGTCCTCCTGCCACTGTT
TTGGCATGGAATTGCGCCAAATGTAATGCCAATCCTACATTCACGCCAGTCGCTGCTGGTGGGAATGGTGCGAGT
GTGCAGTTCTGGTATGTTGGTTACGACGCGAACCTTGCAAGTGTCATTGTCGGCTTCCAAGGAACTGATGCAGAC
AAGATCTTACCCATACTCACGGACGCCGATTTCTTCCTTACTACCCTGGATTCTGGTCTTTTCCCAGGCCTGAGC
AGTGATATCAAGACTCATAACGGATTCAATGATGCCCAAATGGCGTCTGCTTCTGCTGTACTTTCGGCTGTGAAT
ACTGCCATGTCCCGATTTGGTGCCAGACGCGTTACTGTTACTGGTCATTCCCTCGGTGGTGCCATTGCTACGATT
TCCGCTGTACATCTTAAGCTCCATTTGCCCTCGACTACAACGTTCAAGGTCGTTACGTACGGCTGTCCTCGTGTT
GGCAATCAGGCATTTGCCAATTACTTCAACTCTCGCTTCCCTGGTGCCAATTCTCGTATCAACAACCAGGATGAT
ATCGTACCAATTGTTCCTGGACGTTTCCTCGGTTTCGATCACGTTGAAGGAGAGATTCATATCTTGAATAACAAC
GGTTGGGTGTCTTGCCCGGGTCAAGATAACGAAGATGGTGATTGCACTATTGGATATGTCCCTAACATCTTCGCT
GGTGATACTGGTGACCATAGTGGCCCTTATGATGGTATCAGGATGGGTTGTTCATGA
Transcript >AgabiH97|063250
ATGGTCTTTGGACTTCGCACCGGGGATGCTTCGCATCACCGAACAGAGGACAACGGCTACTCTCGATGTGAATAT
ATAAGCGACTATATCGCCTCGTTCAGGCCTTACACCAATTTCGCTGCTGTCGCTGGATGTCCTCCTGCCACTGTT
TTGGCATGGAATTGCGCCAAATGTAATGCCAATCCTACATTCACGCCAGTCGCTGCTGGTGGGAATGGTGCGAGT
GTGCAGTTCTGGTATGTTGGTTACGACGCGAACCTTGCAAGTGTCATTGTCGGCTTCCAAGGAACTGATGCAGAC
AAGATCTTACCCATACTCACGGACGCCGATTTCTTCCTTACTACCCTGGATTCTGGTCTTTTCCCAGGCCTGAGC
AGTGATATCAAGACTCATAACGGATTCAATGATGCCCAAATGGCGTCTGCTTCTGCTGTACTTTCGGCTGTGAAT
ACTGCCATGTCCCGATTTGGTGCCAGACGCGTTACTGTTACTGGTCATTCCCTCGGTGGTGCCATTGCTACGATT
TCCGCTGTACATCTTAAGCTCCATTTGCCCTCGACTACAACGTTCAAGGTCGTTACGTACGGCTGTCCTCGTGTT
GGCAATCAGGCATTTGCCAATTACTTCAACTCTCGCTTCCCTGGTGCCAATTCTCGTATCAACAACCAGGATGAT
ATCGTACCAATTGTTCCTGGACGTTTCCTCGGTTTCGATCACGTTGAAGGAGAGATTCATATCTTGAATAACAAC
GGTTGGGTGTCTTGCCCGGGTCAAGATAACGAAGATGGTGATTGCACTATTGGATATGTCCCTAACATCTTCGCT
GGTGATACTGGTGACCATAGTGGCCCTTATGATGGTATCAGGATGGGTTGTTCATGA
Gene >AgabiH97|063250
ATGGTCTTTGGACTTCGCGTCAGTACCGAATGACTATCGTGTTCAAAAAGATACCAAGAACAGACCGGGGATGGT
GCGTAAAACTTCTAGCGCTACAGCTCACCTGGTTTAATTTCCTTGGCTTAGCTTCGCATCACCGAACAGAGGACA
ACGGCTACTCTCGATGTGAATATATAAGGTTCGTACAGTCCTGCCAATGATTGTAAGGACGGCTTCCCCTGACGT
TCCCTCTCTGGTTTGCTACTGTTCAACTCGTTCATGATGATTGGTACACGCCTGGTCACTCTTCTACTCGCTTGT
GCAGCGACTATAGTCCATGTCAACGCCGCACCTGTGCAAAACCACACCGACGAGACGTCGCCTAACCTGACCAGT
CTCGAAAAACGTGCCACGATCCCTTTGACTTCTTCCCAAGTCGCCTCGTTCAGGCCTTACACCAATTTCGCTGCT
GTCGCTGGATGTCCTCCTGCCACTGTTTTGGCATGGAATTGCGGTATGTCTGATGTTCTTAAATCAACCCCACCA
AAAGTTAAAAAACGGCACTCCACCAACAGCCAAATGTAATGCCAATCCTACATTCACGCCAGTCGCTGCTGGTGG
GAATGGTGCGAGTGTGCAGTTCTGGTATGTTGGTTACGACGCGAACCTTGCAAGTGTCATTGTCGGCTTCCAAGG
AACTGATGCAGACAAGATGTATGTGATCGAAAACCATTTCAATTCTTGATATCGTGATTTAGAAAGCTTACAGCT
TACCCATACTCACGGACGCCGATTTCTTCCTTACTACCCTGGATTCTGGTCTTTTCCCAGGCCTGAGCAGTGATA
TCAAGACTCATAACGGATTCAATGATGCCCAAATGGCGTACGTTACCCTTTTGAAGCTCTGATCTTTTCTTGAAT
CTTAAATATGTGGGTGGGAATAGGTCTGCTTCTGCTGTACTTTCGGCTGTGAATACTGCCATGTCCCGATTTGGT
GCCAGACGCGTTACTGTTACTGGTCATTCCCTCGGTCAGTTCTTCTATACCACCATGCTTGATTGAGAAAAACTG
AATTGAGACTCGTGTATAGGTGGTGCCATTGCTACGATTTCCGCTGTACATCTTAAGCTCCATTTGCCCTCGACT
ACAACGTTCAAGGTCGTTACGTACGGCTGTCCTCGTGTTGGCAATCAGGCATTTGCCAATTACTTCAACTCTCGC
TTCCCTGGTGCCAATTCTCGTATCAACAACCAGTAAATCTTCTTTTCTATCTCTTCCGAGGAAGATGTCAGAATA
TCGACTAACTGATATCTGTAGGGATGATATCGTACCAATTGTTCCTGGACGTTTCCTCGGTTTCGATCACGTTGA
AGGAGAGATTCATATCTTGAATAACAACGGTTGGGTGTCTTGCCCGGGTCAAGATAACGAAGATGGTGATTGCAC
TATTGGATATGTCCCTAACATCTTCGCTGGTGATACTGGTGACCATAGTGGCCCTTATGATGGTATCAGGATGGG
TTGTTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail