Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|063250
Gene name
Locationscaffold_3:2539660..2541170
Strand+
Gene length (bp)1510
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 3.3E-28 92 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 22 246 3.0E-16
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 27 271 1.0E-13
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 80 239 2.0E-12
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 30 271 2.0E-12
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 30 271 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 22 246 3.0E-16
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 27 271 1.0E-13
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 80 239 2.0E-12
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 30 271 2.0E-12
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 30 271 2.0E-12
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 80 239 3.0E-12
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 80 239 3.0E-12
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 80 279 4.0E-12
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 80 279 4.0E-12
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 80 239 8.0E-12
sp|O42815|FAEA_ASPTU Feruloyl esterase A OS=Aspergillus tubingensis GN=faeA PE=3 SV=1 80 239 5.0E-11
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 58 239 1.0E-10
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 58 239 3.0E-10
sp|Q948R1|PLA11_ARATH Phospholipase A(1) DAD1, chloroplastic OS=Arabidopsis thaliana GN=DAD1 PE=1 SV=1 90 235 4.0E-08
sp|Q941F1|PLA15_ARATH Phospholipase A1-Igamma1, chloroplastic OS=Arabidopsis thaliana GN=At1g06800 PE=1 SV=2 90 235 9.0E-08
sp|A2ZW16|PLA1_ORYSJ Phospholipase A1-II 1 OS=Oryza sativa subsp. japonica GN=Os01g0651100 PE=3 SV=2 90 246 1.0E-07
sp|A2WT95|PLA1_ORYSI Phospholipase A1-II 1 OS=Oryza sativa subsp. indica GN=OsI_03083 PE=3 SV=2 90 246 1.0E-07
sp|Q3EBR6|PLA16_ARATH Phospholipase A1-Igamma2, chloroplastic OS=Arabidopsis thaliana GN=At2g30550 PE=1 SV=2 128 235 4.0E-07
sp|Q9XTR8|LIP1_CAEEL Lipase ZK262.3 OS=Caenorhabditis elegans GN=ZK262.3 PE=1 SV=1 152 232 6.0E-07
sp|B8A8C9|PLA5_ORYSI Phospholipase A1-II 5 OS=Oryza sativa subsp. indica GN=OsI_03470 PE=3 SV=1 137 246 3.0E-06
sp|Q5NAI4|PLA5_ORYSJ Phospholipase A1-II 5 OS=Oryza sativa subsp. japonica GN=Os01g0710700 PE=2 SV=1 137 246 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2117 0.1415 0.8951 0.1915 0.2148 0.0752 0.1228 0.3185 0.0586 0.0482

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup106
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|000340
Agaricus bisporus var bisporus H39 AgabiH39|001820
Agaricus bisporus var bisporus H39 AgabiH39|001830
Agaricus bisporus var bisporus H39 AgabiH39|063250
Agaricus bisporus var bisporus H39 AgabiH39|090410
Agaricus bisporus var bisporus H97 AgabiH97|000340
Agaricus bisporus var bisporus H97 AgabiH97|001820
Agaricus bisporus var bisporus H97 AgabiH97|001830
Agaricus bisporus var bisporus H97 AgabiH97|063250 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|090410
Rhodonia placenta FPRL280 RhoplFPRL280|214_10
Rhodonia placenta FPRL280 RhoplFPRL280|283_4
Rhodonia placenta FPRL280 RhoplFPRL280|551_2
Rhodonia placenta FPRL280 RhoplFPRL280|551_3

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|063250
MVFGLRTGDASHHRTEDNGYSRCEYISDYIASFRPYTNFAAVAGCPPATVLAWNCAKCNANPTFTPVAAGGNGAS
VQFWYVGYDANLASVIVGFQGTDADKILPILTDADFFLTTLDSGLFPGLSSDIKTHNGFNDAQMASASAVLSAVN
TAMSRFGARRVTVTGHSLGGAIATISAVHLKLHLPSTTTFKVVTYGCPRVGNQAFANYFNSRFPGANSRINNQDD
IVPIVPGRFLGFDHVEGEIHILNNNGWVSCPGQDNEDGDCTIGYVPNIFAGDTGDHSGPYDGIRMGCS*
Coding >AgabiH97|063250
ATGGTCTTTGGACTTCGCACCGGGGATGCTTCGCATCACCGAACAGAGGACAACGGCTACTCTCGATGTGAATAT
ATAAGCGACTATATCGCCTCGTTCAGGCCTTACACCAATTTCGCTGCTGTCGCTGGATGTCCTCCTGCCACTGTT
TTGGCATGGAATTGCGCCAAATGTAATGCCAATCCTACATTCACGCCAGTCGCTGCTGGTGGGAATGGTGCGAGT
GTGCAGTTCTGGTATGTTGGTTACGACGCGAACCTTGCAAGTGTCATTGTCGGCTTCCAAGGAACTGATGCAGAC
AAGATCTTACCCATACTCACGGACGCCGATTTCTTCCTTACTACCCTGGATTCTGGTCTTTTCCCAGGCCTGAGC
AGTGATATCAAGACTCATAACGGATTCAATGATGCCCAAATGGCGTCTGCTTCTGCTGTACTTTCGGCTGTGAAT
ACTGCCATGTCCCGATTTGGTGCCAGACGCGTTACTGTTACTGGTCATTCCCTCGGTGGTGCCATTGCTACGATT
TCCGCTGTACATCTTAAGCTCCATTTGCCCTCGACTACAACGTTCAAGGTCGTTACGTACGGCTGTCCTCGTGTT
GGCAATCAGGCATTTGCCAATTACTTCAACTCTCGCTTCCCTGGTGCCAATTCTCGTATCAACAACCAGGATGAT
ATCGTACCAATTGTTCCTGGACGTTTCCTCGGTTTCGATCACGTTGAAGGAGAGATTCATATCTTGAATAACAAC
GGTTGGGTGTCTTGCCCGGGTCAAGATAACGAAGATGGTGATTGCACTATTGGATATGTCCCTAACATCTTCGCT
GGTGATACTGGTGACCATAGTGGCCCTTATGATGGTATCAGGATGGGTTGTTCATGA
Transcript >AgabiH97|063250
ATGGTCTTTGGACTTCGCACCGGGGATGCTTCGCATCACCGAACAGAGGACAACGGCTACTCTCGATGTGAATAT
ATAAGCGACTATATCGCCTCGTTCAGGCCTTACACCAATTTCGCTGCTGTCGCTGGATGTCCTCCTGCCACTGTT
TTGGCATGGAATTGCGCCAAATGTAATGCCAATCCTACATTCACGCCAGTCGCTGCTGGTGGGAATGGTGCGAGT
GTGCAGTTCTGGTATGTTGGTTACGACGCGAACCTTGCAAGTGTCATTGTCGGCTTCCAAGGAACTGATGCAGAC
AAGATCTTACCCATACTCACGGACGCCGATTTCTTCCTTACTACCCTGGATTCTGGTCTTTTCCCAGGCCTGAGC
AGTGATATCAAGACTCATAACGGATTCAATGATGCCCAAATGGCGTCTGCTTCTGCTGTACTTTCGGCTGTGAAT
ACTGCCATGTCCCGATTTGGTGCCAGACGCGTTACTGTTACTGGTCATTCCCTCGGTGGTGCCATTGCTACGATT
TCCGCTGTACATCTTAAGCTCCATTTGCCCTCGACTACAACGTTCAAGGTCGTTACGTACGGCTGTCCTCGTGTT
GGCAATCAGGCATTTGCCAATTACTTCAACTCTCGCTTCCCTGGTGCCAATTCTCGTATCAACAACCAGGATGAT
ATCGTACCAATTGTTCCTGGACGTTTCCTCGGTTTCGATCACGTTGAAGGAGAGATTCATATCTTGAATAACAAC
GGTTGGGTGTCTTGCCCGGGTCAAGATAACGAAGATGGTGATTGCACTATTGGATATGTCCCTAACATCTTCGCT
GGTGATACTGGTGACCATAGTGGCCCTTATGATGGTATCAGGATGGGTTGTTCATGA
Gene >AgabiH97|063250
ATGGTCTTTGGACTTCGCGTCAGTACCGAATGACTATCGTGTTCAAAAAGATACCAAGAACAGACCGGGGATGGT
GCGTAAAACTTCTAGCGCTACAGCTCACCTGGTTTAATTTCCTTGGCTTAGCTTCGCATCACCGAACAGAGGACA
ACGGCTACTCTCGATGTGAATATATAAGGTTCGTACAGTCCTGCCAATGATTGTAAGGACGGCTTCCCCTGACGT
TCCCTCTCTGGTTTGCTACTGTTCAACTCGTTCATGATGATTGGTACACGCCTGGTCACTCTTCTACTCGCTTGT
GCAGCGACTATAGTCCATGTCAACGCCGCACCTGTGCAAAACCACACCGACGAGACGTCGCCTAACCTGACCAGT
CTCGAAAAACGTGCCACGATCCCTTTGACTTCTTCCCAAGTCGCCTCGTTCAGGCCTTACACCAATTTCGCTGCT
GTCGCTGGATGTCCTCCTGCCACTGTTTTGGCATGGAATTGCGGTATGTCTGATGTTCTTAAATCAACCCCACCA
AAAGTTAAAAAACGGCACTCCACCAACAGCCAAATGTAATGCCAATCCTACATTCACGCCAGTCGCTGCTGGTGG
GAATGGTGCGAGTGTGCAGTTCTGGTATGTTGGTTACGACGCGAACCTTGCAAGTGTCATTGTCGGCTTCCAAGG
AACTGATGCAGACAAGATGTATGTGATCGAAAACCATTTCAATTCTTGATATCGTGATTTAGAAAGCTTACAGCT
TACCCATACTCACGGACGCCGATTTCTTCCTTACTACCCTGGATTCTGGTCTTTTCCCAGGCCTGAGCAGTGATA
TCAAGACTCATAACGGATTCAATGATGCCCAAATGGCGTACGTTACCCTTTTGAAGCTCTGATCTTTTCTTGAAT
CTTAAATATGTGGGTGGGAATAGGTCTGCTTCTGCTGTACTTTCGGCTGTGAATACTGCCATGTCCCGATTTGGT
GCCAGACGCGTTACTGTTACTGGTCATTCCCTCGGTCAGTTCTTCTATACCACCATGCTTGATTGAGAAAAACTG
AATTGAGACTCGTGTATAGGTGGTGCCATTGCTACGATTTCCGCTGTACATCTTAAGCTCCATTTGCCCTCGACT
ACAACGTTCAAGGTCGTTACGTACGGCTGTCCTCGTGTTGGCAATCAGGCATTTGCCAATTACTTCAACTCTCGC
TTCCCTGGTGCCAATTCTCGTATCAACAACCAGTAAATCTTCTTTTCTATCTCTTCCGAGGAAGATGTCAGAATA
TCGACTAACTGATATCTGTAGGGATGATATCGTACCAATTGTTCCTGGACGTTTCCTCGGTTTCGATCACGTTGA
AGGAGAGATTCATATCTTGAATAACAACGGTTGGGTGTCTTGCCCGGGTCAAGATAACGAAGATGGTGATTGCAC
TATTGGATATGTCCCTAACATCTTCGCTGGTGATACTGGTGACCATAGTGGCCCTTATGATGGTATCAGGATGGG
TTGTTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail