Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|063210
Gene name
Locationscaffold_3:2528162..2529042
Strand-
Gene length (bp)880
Transcript length (bp)717
Coding sequence length (bp)717
Protein length (aa) 239

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 6.5E-15 58 212
PF08241 Methyltransf_11 Methyltransferase domain 5.6E-13 76 170
PF13847 Methyltransf_31 Methyltransferase domain 9.2E-13 70 189
PF13649 Methyltransf_25 Methyltransferase domain 3.2E-12 75 166
PF08242 Methyltransf_12 Methyltransferase domain 6.5E-09 75 168
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 5.2E-05 61 171
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 6.3E-05 58 171

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94628|YGE9_SCHPO Uncharacterized methyltransferase C1347.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1347.09 PE=3 SV=1 75 211 2.0E-18
sp|P65347|Y092_MYCBO Uncharacterized methyltransferase Mb0092 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0092 PE=3 SV=1 75 186 8.0E-07
sp|P9WK03|Y089_MYCTU Uncharacterized methyltransferase Rv0089 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0089 PE=3 SV=1 75 186 8.0E-07
sp|P9WK02|Y089_MYCTO Uncharacterized methyltransferase MT0098 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0098 PE=3 SV=1 75 186 8.0E-07

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|063210
MSLHSHTHHTHHQHQHQHQHHSHGHVTAAQANKDYFDDPEHAQENFPHVEDLAARVAKGIIKNYDKLEKEKTVAM
DFACGNGFVSKGLMPFVKSILGVDISPVVVEKYNANFKDEDASAVCMELKGEKGELENAQFDLIFCTAAYHHLES
YEEMTRILTSFLNPGGALIVADMVHVEGLQHFLAAVEHAVPHKHGLSKDDIQRAFDGAGLTMKSFNLLPPAEYEF
PNIFIAIGEKPSV*
Coding >AgabiH97|063210
ATGTCTTTGCACTCTCATACTCATCATACTCATCACCAACACCAACACCAACACCAACACCACAGCCACGGCCAT
GTCACTGCTGCTCAGGCTAACAAAGATTACTTTGATGATCCTGAACATGCTCAAGAAAACTTCCCTCATGTCGAG
GACCTTGCGGCAAGGGTCGCCAAAGGTATCATTAAGAATTATGACAAACTTGAAAAGGAAAAGACCGTTGCGATG
GATTTCGCTTGTGGCAATGGATTTGTTTCCAAGGGATTGATGCCATTTGTGAAGTCAATCTTGGGTGTCGACATC
AGCCCAGTCGTTGTGGAGAAATACAATGCTAACTTCAAGGACGAGGACGCCTCTGCTGTCTGTATGGAACTCAAG
GGCGAGAAAGGCGAACTCGAGAATGCTCAGTTTGACCTCATTTTCTGTACTGCTGCATATCACCATCTGGAGTCC
TATGAAGAAATGACTCGCATCTTGACATCCTTCCTTAACCCCGGAGGTGCCCTCATTGTAGCGGATATGGTACAC
GTAGAAGGCTTACAACATTTCTTGGCTGCCGTTGAACACGCAGTTCCCCATAAGCATGGATTGTCAAAGGACGAC
ATACAGAGAGCGTTCGATGGAGCAGGCTTGACGATGAAATCCTTCAACCTATTACCTCCTGCTGAATACGAGTTT
CCTAATATCTTCATCGCCATCGGAGAGAAACCCTCTGTGTAA
Transcript >AgabiH97|063210
ATGTCTTTGCACTCTCATACTCATCATACTCATCACCAACACCAACACCAACACCAACACCACAGCCACGGCCAT
GTCACTGCTGCTCAGGCTAACAAAGATTACTTTGATGATCCTGAACATGCTCAAGAAAACTTCCCTCATGTCGAG
GACCTTGCGGCAAGGGTCGCCAAAGGTATCATTAAGAATTATGACAAACTTGAAAAGGAAAAGACCGTTGCGATG
GATTTCGCTTGTGGCAATGGATTTGTTTCCAAGGGATTGATGCCATTTGTGAAGTCAATCTTGGGTGTCGACATC
AGCCCAGTCGTTGTGGAGAAATACAATGCTAACTTCAAGGACGAGGACGCCTCTGCTGTCTGTATGGAACTCAAG
GGCGAGAAAGGCGAACTCGAGAATGCTCAGTTTGACCTCATTTTCTGTACTGCTGCATATCACCATCTGGAGTCC
TATGAAGAAATGACTCGCATCTTGACATCCTTCCTTAACCCCGGAGGTGCCCTCATTGTAGCGGATATGGTACAC
GTAGAAGGCTTACAACATTTCTTGGCTGCCGTTGAACACGCAGTTCCCCATAAGCATGGATTGTCAAAGGACGAC
ATACAGAGAGCGTTCGATGGAGCAGGCTTGACGATGAAATCCTTCAACCTATTACCTCCTGCTGAATACGAGTTT
CCTAATATCTTCATCGCCATCGGAGAGAAACCCTCTGTGTAA
Gene >AgabiH97|063210
ATGTCTTTGCACTCTCATACTCATCATACTCATCACCAACACCAACACCAACACCAACACCACAGCCACGGCCAT
GTCACTGCTGCTCAGGCTAACAAAGATTACTTTGATGATCCTGAACATGCTCAAGAAAACTTCCCTCATGTCGAG
GACCTTGCGGCAAGGTGCGCACAGCGTTTTCTTTCAAAAATCAATCAAGGCGCTGATTGTCATATCAGGGTCGCC
AAAGGTATCATTAAGAATTATGACAAACTTGAAAAGGAAAAGACCGTTGCGATGGATTTCGCTTGTGGCAATGGT
ATGTATTGCTCATTGACCTTTGAATGCAGGATATGGATACTCACGACGCAATAGGATTTGTTTCCAAGGGATTGA
TGCCATTTGTGAAGTCAATCTTGGGTGTCGACATCAGCCCAGTCGTTGTGGAGAAATACAATGCTAACTTCAAGG
ACGAGGACGCCTCTGCTGTCTGTATGGAACTCAAGGGCGAGAAAGGCGAACTCGAGAATGCTCAGTTTGACCTCA
TTTTCGTAAGCCATTTGTTGTCAAACTGTGTAAGACAGCTAATGTGAGTATGATGCAGTGTACTGCTGCATATCA
CCATCTGGAGTCCTATGAAGAAATGACTCGCATCTTGACATCCTTCCTTAACCCCGGAGGTGCCCTCATTGTAGC
GGATATGGTACACGTAGAAGGCTTACAACATTTCTTGGCTGCCGTTGAACACGCAGTTCCCCATAAGCATGGATT
GTCAAAGGACGACATACAGAGAGCGTTCGATGGAGCAGGCTTGACGATGAAATCCTTCAACCTATTACCTCCTGC
TGAATACGAGTTTCCTAATATCTTCATCGCCATCGGAGAGAAACCCTCTGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail