Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|063200
Gene name
Locationscaffold_3:2526901..2527862
Strand+
Gene length (bp)961
Transcript length (bp)681
Coding sequence length (bp)681
Protein length (aa) 227

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 2.4E-16 37 161
PF13649 Methyltransf_25 Methyltransferase domain 2.1E-15 49 150
PF08242 Methyltransf_12 Methyltransferase domain 7.9E-14 50 152
PF13847 Methyltransf_31 Methyltransferase domain 1.3E-13 44 158
PF08241 Methyltransf_11 Methyltransferase domain 8.1E-13 50 154
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.1E-09 43 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94628|YGE9_SCHPO Uncharacterized methyltransferase C1347.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1347.09 PE=3 SV=1 49 197 7.0E-23
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 46 156 7.0E-11
sp|Q8PK00|UBIG_XANAC Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiG PE=3 SV=1 2 157 3.0E-09
sp|Q3BSF8|UBIG_XANC5 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiG PE=3 SV=1 2 157 4.0E-09
sp|Q5GZB5|UBIG_XANOR Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiG PE=3 SV=1 3 157 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94628|YGE9_SCHPO Uncharacterized methyltransferase C1347.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1347.09 PE=3 SV=1 49 197 7.0E-23
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 46 156 7.0E-11
sp|Q8PK00|UBIG_XANAC Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiG PE=3 SV=1 2 157 3.0E-09
sp|Q3BSF8|UBIG_XANC5 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiG PE=3 SV=1 2 157 4.0E-09
sp|Q5GZB5|UBIG_XANOR Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiG PE=3 SV=1 3 157 2.0E-07
sp|B2SHS9|UBIG_XANOP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiG PE=3 SV=1 3 157 2.0E-07
sp|Q2P2C4|UBIG_XANOM Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiG PE=3 SV=1 3 157 2.0E-07
sp|Q2L2T5|UBIG_BORA1 Ubiquinone biosynthesis O-methyltransferase OS=Bordetella avium (strain 197N) GN=ubiG PE=3 SV=1 48 160 4.0E-07
sp|B0RS27|UBIG_XANCB Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiG PE=3 SV=1 2 157 7.0E-07
sp|Q4UVL4|UBIG_XANC8 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiG PE=3 SV=1 2 157 7.0E-07
sp|Q8P8H2|UBIG_XANCP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiG PE=3 SV=1 2 157 7.0E-07
sp|B0U3W1|UBIG_XYLFM Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M12) GN=ubiG PE=3 SV=1 3 154 7.0E-07
sp|Q9PAM5|UBIG_XYLFA Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=ubiG PE=3 SV=1 3 154 1.0E-06
sp|Q7VZG7|UBIG_BORPE Ubiquinone biosynthesis O-methyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ubiG PE=3 SV=1 48 160 1.0E-06
sp|Q7WGT9|UBIG_BORBR Ubiquinone biosynthesis O-methyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ubiG PE=3 SV=2 48 160 1.0E-06
sp|Q87BG5|UBIG_XYLFT Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ubiG PE=3 SV=1 3 154 2.0E-06
sp|B2I705|UBIG_XYLF2 Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M23) GN=ubiG PE=3 SV=1 3 154 2.0E-06
sp|A3DBD7|BIOC_CLOTH Malonyl-[acyl-carrier protein] O-methyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bioC PE=3 SV=1 18 152 2.0E-06
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 48 204 3.0E-06
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 48 204 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|063200
MSNYSLSNKDYYDQLGEQNFDAPHALELARRAANVFRRAYDFDEDETRVLDFACGVGHLSRELVPYVKSIVGVDI
SQRMVDEYNRRSLNQGIEPEEMRAIKADILLSSTSSELQEMKGTYDVVVCAAAYHHFDDITAMTRALVEFLKSGG
MLLVLDLLKDENVDTEELFPEHRQHDIVAHRGGLSKAQMEEAFVAAAGLQSFKMSDAIKARKRGHPTTLFLAQGI
K*
Coding >AgabiH97|063200
ATGTCCAATTATAGTCTATCAAACAAAGACTACTATGATCAATTAGGAGAGCAGAATTTCGATGCTCCTCATGCA
CTCGAGCTGGCAAGAAGGGCTGCTAATGTTTTTCGCCGGGCATATGATTTCGACGAGGACGAGACCAGAGTTTTG
GATTTCGCATGCGGCGTAGGTCATTTGTCAAGGGAATTGGTACCATACGTTAAATCTATCGTGGGCGTGGATATT
AGTCAACGGATGGTAGACGAGTATAATCGCCGATCTCTCAATCAAGGAATTGAGCCAGAAGAAATGCGGGCTATT
AAAGCAGACATCCTCCTCTCCTCGACGTCGAGTGAACTGCAAGAAATGAAGGGAACCTATGACGTCGTCGTCTGT
GCTGCTGCCTACCACCATTTTGATGATATCACTGCCATGACAAGAGCCCTCGTCGAGTTCCTGAAATCGGGCGGC
ATGTTGCTTGTTTTGGATCTTTTGAAGGACGAGAACGTTGATACTGAGGAGTTGTTTCCCGAGCACAGACAACAT
GATATCGTGGCTCACCGAGGGGGACTTTCGAAAGCTCAAATGGAGGAGGCCTTTGTCGCGGCTGCTGGTCTTCAG
TCGTTTAAAATGAGTGACGCGATCAAGGCTAGAAAACGAGGGCATCCAACCACTCTTTTCCTCGCTCAAGGTATT
AAATAA
Transcript >AgabiH97|063200
ATGTCCAATTATAGTCTATCAAACAAAGACTACTATGATCAATTAGGAGAGCAGAATTTCGATGCTCCTCATGCA
CTCGAGCTGGCAAGAAGGGCTGCTAATGTTTTTCGCCGGGCATATGATTTCGACGAGGACGAGACCAGAGTTTTG
GATTTCGCATGCGGCGTAGGTCATTTGTCAAGGGAATTGGTACCATACGTTAAATCTATCGTGGGCGTGGATATT
AGTCAACGGATGGTAGACGAGTATAATCGCCGATCTCTCAATCAAGGAATTGAGCCAGAAGAAATGCGGGCTATT
AAAGCAGACATCCTCCTCTCCTCGACGTCGAGTGAACTGCAAGAAATGAAGGGAACCTATGACGTCGTCGTCTGT
GCTGCTGCCTACCACCATTTTGATGATATCACTGCCATGACAAGAGCCCTCGTCGAGTTCCTGAAATCGGGCGGC
ATGTTGCTTGTTTTGGATCTTTTGAAGGACGAGAACGTTGATACTGAGGAGTTGTTTCCCGAGCACAGACAACAT
GATATCGTGGCTCACCGAGGGGGACTTTCGAAAGCTCAAATGGAGGAGGCCTTTGTCGCGGCTGCTGGTCTTCAG
TCGTTTAAAATGAGTGACGCGATCAAGGCTAGAAAACGAGGGCATCCAACCACTCTTTTCCTCGCTCAAGGTATT
AAATAA
Gene >AgabiH97|063200
ATGTCCAATTATAGTCTATCAAACAAAGACTACTATGATCAATTAGGAGAGCAGAATTTCGATGCTCCTCATGCA
CTCGAGCTGGCAAGAAGGTTATTATCACATCACATTCCTAACGCATCGTTCTCGGACATTACATTTGCATCACAC
ATCACAAAACTGTCATGTAAATGGGTTTCTATCAGTTTCAGTAGTTGTGCTATTTTCTAAGAGTGTTGTGGATGA
TCAACTCACATAGATGCATCTATCAATCTTAGGGCTGCTAATGTTTTTCGCCGGGCATATGATTTCGACGAGGAC
GAGACCAGAGTTTTGGATTTCGCATGCGGCGTAGGTGCGTCAAAAACGTTTTTAATCTCTTTTGCCTGTGTATCA
ATTACTTTCGCCCCGCTAGGTCATTTGTCAAGGGAATTGGTACCATACGTTAAATCTATCGTGGGCGTGGATATT
AGTCAACGGATGGTAGACGAGTATAATCGCCGATCTCTCAATCAAGGAATTGAGCCAGAAGAAATGCGGGCTATT
AAAGCAGACATCCTCCTCTCCTCGACGTCGAGTGAACTGCAAGAAATGAAGGGAACCTATGACGTCGTCGTCGTA
AGTCGATATATTAACATATATAACAAGTTCCCGAGATTAATCTTAGGACAAGTGTGCTGCTGCCTACCACCATTT
TGATGATATCACTGCCATGACAAGAGCCCTCGTCGAGTTCCTGAAATCGGGCGGCATGTTGCTTGTTTTGGATCT
TTTGAAGGACGAGAACGTTGATACTGAGGAGTTGTTTCCCGAGCACAGACAACATGATATCGTGGCTCACCGAGG
GGGACTTTCGAAAGCTCAAATGGAGGAGGCCTTTGTCGCGGCTGCTGGTCTTCAGTCGTTTAAAATGAGTGACGC
GATCAAGGCTAGAAAACGAGGGCATCCAACCACTCTTTTCCTCGCTCAAGGTATTAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail