Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|063100
Gene name
Locationscaffold_3:2503213..2504532
Strand-
Gene length (bp)1319
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 1.5E-15 68 254
PF17778 BLACT_WH Beta-lactamase associated winged helix domain 9.8E-15 323 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0V9A9|LACB2_XENTR Beta-lactamase-like protein 2 OS=Xenopus tropicalis GN=lactb2 PE=2 SV=1 41 360 5.0E-54
sp|Q5XGR8|LACB2_XENLA Beta-lactamase-like protein 2 OS=Xenopus laevis GN=lactb2 PE=2 SV=1 44 360 2.0E-52
sp|Q1LZ83|LACB2_BOVIN Beta-lactamase-like protein 2 OS=Bos taurus GN=LACTB2 PE=2 SV=1 44 373 9.0E-52
sp|Q561R9|LACB2_RAT Beta-lactamase-like protein 2 OS=Rattus norvegicus GN=Lactb2 PE=2 SV=1 44 373 2.0E-50
sp|Q99KR3|LACB2_MOUSE Beta-lactamase-like protein 2 OS=Mus musculus GN=Lactb2 PE=1 SV=1 44 362 7.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0V9A9|LACB2_XENTR Beta-lactamase-like protein 2 OS=Xenopus tropicalis GN=lactb2 PE=2 SV=1 41 360 5.0E-54
sp|Q5XGR8|LACB2_XENLA Beta-lactamase-like protein 2 OS=Xenopus laevis GN=lactb2 PE=2 SV=1 44 360 2.0E-52
sp|Q1LZ83|LACB2_BOVIN Beta-lactamase-like protein 2 OS=Bos taurus GN=LACTB2 PE=2 SV=1 44 373 9.0E-52
sp|Q561R9|LACB2_RAT Beta-lactamase-like protein 2 OS=Rattus norvegicus GN=Lactb2 PE=2 SV=1 44 373 2.0E-50
sp|Q99KR3|LACB2_MOUSE Beta-lactamase-like protein 2 OS=Mus musculus GN=Lactb2 PE=1 SV=1 44 362 7.0E-50
sp|Q6NYF0|LACB2_DANRE Beta-lactamase-like protein 2 OS=Danio rerio GN=lactb2 PE=2 SV=1 44 373 5.0E-49
sp|Q9VLS9|LACB2_DROME Beta-lactamase-like protein 2 homolog OS=Drosophila melanogaster GN=CG12375 PE=2 SV=1 44 358 2.0E-48
sp|Q53H82|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2 44 339 3.0E-44
sp|Q95Q18|LACB2_CAEEL Beta-lactamase-like protein 2 homolog OS=Caenorhabditis elegans GN=Y53F4B.39 PE=3 SV=1 47 360 1.0E-43
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|063100
MIGLLTRLPSVSSHTRFVFNCGLFNRALSSSTKFRNMVEKLEDLPDISKISANVTRILGQNPGKFTLQGTNTYVI
GTQHPYVLVDPGEGKQEYLPLLASALDALSSNTNTLPEVSDIMISHWHSDHVGGLPSVLSLLQSRWQSRNPTTPL
SSYPAPKLHKYPLPSDIAGPASTAHNKLPEIIESLPKGAFTPTPDGKPFHDLHDNQLFRASSPAIRVIHSPGHTL
DSIALDIPDDHALYTADTVLGQGTAVFEDLRLYLQSLNKLLEYGGGAPEGYQTLYPAHGPIVKSGHELISTYIKH
RLDREQQVLEVLRTKPTEGDAWTTWTIVKVLYASYPESLWIPASHSIDLHLKKLQDEGTVVFLGGEGVEKAWKLD
CEGPSS*
Coding >AgabiH97|063100
ATGATAGGCCTCCTGACCCGTCTTCCGAGTGTCTCCAGCCACACCCGCTTCGTCTTCAATTGTGGCCTGTTTAAC
CGTGCTCTATCTTCGAGTACAAAGTTCAGAAACATGGTAGAAAAACTAGAGGATTTGCCCGACATCTCCAAGATC
AGCGCCAACGTAACGCGGATTCTTGGACAGAATCCTGGAAAGTTCACTCTTCAAGGAACTAACACCTATGTCATC
GGTACTCAACATCCCTATGTCCTCGTTGATCCAGGAGAAGGAAAACAAGAATATCTTCCCCTTCTTGCCTCCGCC
CTAGATGCCCTCTCATCAAATACAAATACACTCCCCGAAGTCTCTGATATCATGATTTCGCATTGGCATTCCGAC
CACGTCGGTGGTCTCCCATCTGTTCTCTCTCTACTTCAATCACGTTGGCAATCCCGTAACCCAACAACTCCGCTA
TCCTCGTATCCAGCTCCCAAACTACATAAATACCCTCTTCCATCAGATATCGCCGGTCCTGCATCTACTGCTCAT
AACAAACTACCCGAAATCATCGAATCTTTACCCAAAGGCGCATTCACACCTACACCCGACGGCAAACCCTTCCAT
GACCTACACGATAATCAGCTCTTTCGCGCATCGTCACCCGCGATCCGTGTAATCCATTCTCCTGGTCATACGCTT
GACTCTATAGCTCTAGATATACCAGACGACCATGCACTATACACGGCAGACACAGTTCTAGGACAAGGCACCGCC
GTCTTTGAAGATCTCAGATTGTATCTGCAATCTCTCAACAAATTGCTTGAATATGGCGGGGGAGCTCCTGAGGGT
TATCAGACTCTCTATCCGGCACACGGACCTATCGTCAAATCTGGTCATGAACTCATCTCCACTTATATTAAACAT
CGCCTTGACCGTGAGCAGCAAGTGCTGGAAGTGTTGCGAACGAAGCCAACGGAAGGCGATGCTTGGACTACTTGG
ACAATCGTCAAAGTTCTCTACGCGTCATATCCCGAGAGCCTCTGGATTCCAGCCTCTCATAGTATTGACCTTCAT
CTTAAGAAATTGCAAGATGAGGGTACTGTCGTGTTCCTGGGAGGTGAAGGTGTGGAAAAGGCTTGGAAGCTAGAC
TGCGAAGGTCCATCGTCGTAG
Transcript >AgabiH97|063100
ATGATAGGCCTCCTGACCCGTCTTCCGAGTGTCTCCAGCCACACCCGCTTCGTCTTCAATTGTGGCCTGTTTAAC
CGTGCTCTATCTTCGAGTACAAAGTTCAGAAACATGGTAGAAAAACTAGAGGATTTGCCCGACATCTCCAAGATC
AGCGCCAACGTAACGCGGATTCTTGGACAGAATCCTGGAAAGTTCACTCTTCAAGGAACTAACACCTATGTCATC
GGTACTCAACATCCCTATGTCCTCGTTGATCCAGGAGAAGGAAAACAAGAATATCTTCCCCTTCTTGCCTCCGCC
CTAGATGCCCTCTCATCAAATACAAATACACTCCCCGAAGTCTCTGATATCATGATTTCGCATTGGCATTCCGAC
CACGTCGGTGGTCTCCCATCTGTTCTCTCTCTACTTCAATCACGTTGGCAATCCCGTAACCCAACAACTCCGCTA
TCCTCGTATCCAGCTCCCAAACTACATAAATACCCTCTTCCATCAGATATCGCCGGTCCTGCATCTACTGCTCAT
AACAAACTACCCGAAATCATCGAATCTTTACCCAAAGGCGCATTCACACCTACACCCGACGGCAAACCCTTCCAT
GACCTACACGATAATCAGCTCTTTCGCGCATCGTCACCCGCGATCCGTGTAATCCATTCTCCTGGTCATACGCTT
GACTCTATAGCTCTAGATATACCAGACGACCATGCACTATACACGGCAGACACAGTTCTAGGACAAGGCACCGCC
GTCTTTGAAGATCTCAGATTGTATCTGCAATCTCTCAACAAATTGCTTGAATATGGCGGGGGAGCTCCTGAGGGT
TATCAGACTCTCTATCCGGCACACGGACCTATCGTCAAATCTGGTCATGAACTCATCTCCACTTATATTAAACAT
CGCCTTGACCGTGAGCAGCAAGTGCTGGAAGTGTTGCGAACGAAGCCAACGGAAGGCGATGCTTGGACTACTTGG
ACAATCGTCAAAGTTCTCTACGCGTCATATCCCGAGAGCCTCTGGATTCCAGCCTCTCATAGTATTGACCTTCAT
CTTAAGAAATTGCAAGATGAGGGTACTGTCGTGTTCCTGGGAGGTGAAGGTGTGGAAAAGGCTTGGAAGCTAGAC
TGCGAAGGTCCATCGTCGTAG
Gene >AgabiH97|063100
ATGATAGGCCTCCTGACCCGTCTTCCGAGTGTCTCCAGCCACACCCGCTTCGTCTTCAATTGTGGCCTGTTTAAC
CGTGCTCTATCTTCGAGTACAAAGTTCAGAAACATGGTAGAAAAACTAGAGGATTTGCCCGACATCTCCAAGGTG
CGCCGTCTTCTGTTTCGGACAATGAAGTGATTGAACTCTTTTTGCTAGATCAGCGCCAACGTAACGCGGATTCTT
GGACAGGTCAGTCGCCTGTATTGTGCTACAATTCTTATTCACCTCATGTACCATTTTTGCCACTAGAATCCTGGA
AAGTTCACTCTTCAAGGTCCCCTGCTGCAATTAGAATGTTTGAATCCCTGCTTATGGTTTCCGAATATCTTTTTG
CAGGAACTAACACCTATGTCATCGGTACTCAACATCCCTATGTCCTCGTTGATCCAGGAGAAGGAAAACAAGAAT
ATCTTCCCCTTCTTGCCTCCGCCCTAGATGCCCTCTCATCAAATACAAATACACTCCCCGAAGTCTCTGATATCA
TGATTTCGCATTGGCATTCCGACCACGTCGGTGGTCTCCCATCTGTTCTCTCTCTACTTCAATCACGTTGGCAAT
CCCGTAACCCAACAACTCCGCTATCCTCGTATCCAGCTCCCAAACTACATAAATACCCTCTTCCATCAGATATCG
CCGGTCCTGCATCTACTGCTCATAACAAACTACCCGAAATCATCGAATCTTTACCCAAAGGCGCATTCACACCTA
CACCCGACGGCAAACCCTTCCATGACCTACACGATAATCAGCTCTTTCGCGCATCGTCACCCGCGATCCGTGTAA
TCCATTCTCCTGGTCATACGCTTGACTCTATAGCTCTAGATATACCAGACGACCATGCACTATACACGGCAGACA
CAGTTCTAGGACAAGGCACCGCCGTCTTTGAAGATCTCAGATTGTATCTGCAATCTCTCAACAAATTGCTTGAAT
ATGGCGGGGGAGCTCCTGAGGGTTATCAGACTCTCTATCCGGCACACGGACCTATCGTCAAATCTGGTCATGAAC
TCATCTCCACTTATATTAAACATCGCCTTGACCGTGAGCAGCAAGTGCTGGAAGTGTTGCGAACGAAGCCAACGG
AAGGCGATGCTTGGACTACTTGGACAATCGTCAAAGTTCTCTACGCGTCATATCCCGAGAGCCTCTGGATTCCAG
CCTCTCATAGTATTGACCTTCATCTTAAGAAATTGCAAGATGAGGGTACTGTCGTGTTCCTGGGAGGTGAAGGTG
TGGAAAAGGCTTGGAAGCTAGACTGCGAAGGTCCATCGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail