Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|063010
Gene name
Locationscaffold_3:2480993..2482605
Strand-
Gene length (bp)1612
Transcript length (bp)1332
Coding sequence length (bp)1332
Protein length (aa) 444

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03345 DDOST_48kD Oligosaccharyltransferase 48 kDa subunit beta 1.2E-117 27 426

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P45971|OST48_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Caenorhabditis elegans GN=ostb-1 PE=3 SV=1 7 426 4.0E-55
sp|Q6NYS8|OST48_DANRE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Danio rerio GN=ddost PE=2 SV=2 7 426 1.0E-50
sp|Q54E62|OST48_DICDI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Dictyostelium discoideum GN=ddost PE=3 SV=1 8 426 8.0E-50
sp|Q24319|OST48_DROME Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Drosophila melanogaster GN=Ost48 PE=2 SV=2 5 426 3.0E-49
sp|P39656|OST48_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens GN=DDOST PE=1 SV=4 19 426 4.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P45971|OST48_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Caenorhabditis elegans GN=ostb-1 PE=3 SV=1 7 426 4.0E-55
sp|Q6NYS8|OST48_DANRE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Danio rerio GN=ddost PE=2 SV=2 7 426 1.0E-50
sp|Q54E62|OST48_DICDI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Dictyostelium discoideum GN=ddost PE=3 SV=1 8 426 8.0E-50
sp|Q24319|OST48_DROME Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Drosophila melanogaster GN=Ost48 PE=2 SV=2 5 426 3.0E-49
sp|P39656|OST48_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens GN=DDOST PE=1 SV=4 19 426 4.0E-49
sp|Q5R501|OST48_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Pongo abelii GN=DDOST PE=2 SV=2 19 426 6.0E-49
sp|Q641Y0|OST48_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Rattus norvegicus GN=Ddost PE=2 SV=1 21 426 6.0E-49
sp|O54734|OST48_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Mus musculus GN=Ddost PE=1 SV=2 21 426 2.0E-48
sp|P48440|OST48_CHICK Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Gallus gallus GN=DDOST PE=1 SV=1 28 426 2.0E-48
sp|B1H3C9|OST48_XENTR Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Xenopus tropicalis GN=ddost PE=2 SV=1 7 426 2.0E-48
sp|A6QPY0|OST48_BOVIN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Bos taurus GN=DDOST PE=2 SV=2 23 426 6.0E-48
sp|Q6GNR9|OST48_XENLA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Xenopus laevis GN=ddost PE=2 SV=1 23 426 8.0E-48
sp|Q29381|OST48_PIG Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Sus scrofa GN=DDOST PE=1 SV=2 22 426 2.0E-47
sp|Q05052|OST48_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Canis lupus familiaris GN=DDOST PE=1 SV=1 21 426 6.0E-47
sp|Q944K2|OST48_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Arabidopsis thaliana GN=OST48 PE=2 SV=1 36 426 1.0E-43
sp|Q6ZLK0|OST48_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Oryza sativa subsp. japonica GN=OST48 PE=2 SV=1 24 426 1.0E-43
sp|O59866|OSTB_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit wbp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wbp1 PE=2 SV=2 4 426 7.0E-37
sp|P33767|OSTB_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WBP1 PE=1 SV=1 38 435 1.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0018279 protein N-linked glycosylation via asparagine Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031090 organelle membrane No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0018193 peptidyl-amino acid modification No
GO:0016020 membrane No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0006486 protein glycosylation No
GO:0043413 macromolecule glycosylation No
GO:0043170 macromolecule metabolic process No
GO:0018196 peptidyl-asparagine modification No
GO:0006807 nitrogen compound metabolic process No
GO:0006487 protein N-linked glycosylation No
GO:0036211 protein modification process No
GO:0044238 primary metabolic process No
GO:0070085 glycosylation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 404 426 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|063010
MVAFKRLLLLAAAFASSYAKSSSGDSVLVIVEPKKQADYTIFLDGLREKGYDLTFRSPRADAPLLTQDGVPSFSH
VIFFAPDTKSFPSDITPQSLVSLLGSKTNLLITLSTKQTSLTSLAAEFSLAPAPPGTPLISYFPERSEPLNVVPI
QPPSTSQILSQNMAPVWFSGTPFALGNNPMLVPILNAPPYAFASEVDGGSADSLVDAAEKGGEGLWAGSRMGVVT
GFQTTTGARVVWAGGAELFSDEYAKKQISQGVESGNKQFVQEVASWAFQESLVLRIDHTEHHKFNTTTPSELYTT
SDELVYTAQVSRFYPERGVWQPCSDLKDLQLEFTMLDPHIRIALPPVEGKPGTYSVQFRAPDRHGVFKFVINYKR
KGFTHLLSSTTVSVVPPRHDEYPRFISAAWPYYMGAISTSVGFFVFSAIWLGGEVKAFDKKGKGRKAE*
Coding >AgabiH97|063010
ATGGTCGCCTTCAAACGGCTTTTGTTGCTGGCAGCCGCCTTTGCCTCGTCCTACGCCAAGTCCAGCTCGGGTGAC
TCTGTCCTCGTCATCGTAGAGCCCAAAAAACAAGCAGACTACACCATATTCCTCGATGGGCTTCGAGAAAAAGGC
TATGACTTGACTTTCAGATCTCCTCGCGCAGATGCGCCTCTTCTCACTCAGGACGGCGTTCCCAGTTTCTCCCAT
GTCATCTTCTTTGCTCCCGACACCAAATCCTTCCCAAGCGACATTACACCACAATCTCTTGTCTCTCTCTTGGGC
AGCAAAACTAACCTCCTCATCACGCTTTCCACAAAACAGACATCCCTCACCTCCCTTGCAGCCGAGTTCTCACTC
GCACCTGCACCCCCAGGGACGCCCTTAATATCCTATTTCCCAGAACGATCTGAGCCTCTGAATGTCGTCCCCATT
CAACCTCCATCGACCAGCCAAATCCTCTCTCAAAACATGGCACCAGTATGGTTCTCTGGTACACCATTCGCTCTG
GGTAACAATCCTATGCTTGTACCTATTTTAAATGCACCTCCATATGCATTTGCATCAGAGGTGGATGGCGGTTCG
GCAGACTCGCTTGTGGATGCTGCTGAGAAGGGAGGAGAAGGACTTTGGGCTGGAAGTCGAATGGGAGTCGTTACT
GGATTCCAAACTACCACTGGAGCGCGTGTTGTTTGGGCTGGTGGTGCTGAGCTTTTCAGTGATGAATATGCTAAA
AAACAGATTTCCCAGGGCGTTGAATCTGGTAATAAGCAGTTTGTTCAGGAAGTCGCGTCATGGGCTTTCCAAGAG
TCCCTTGTGTTGCGTATCGACCATACTGAGCATCATAAATTCAATACAACCACGCCTAGTGAACTATATACCACA
AGTGACGAACTCGTCTATACCGCTCAAGTTTCCAGGTTTTATCCCGAACGCGGTGTATGGCAACCCTGTTCGGAT
CTTAAAGATCTTCAGTTAGAATTCACGATGCTCGACCCTCATATTCGTATCGCTCTTCCTCCAGTCGAAGGTAAA
CCCGGAACGTACTCTGTCCAATTCCGCGCTCCAGATCGTCATGGTGTCTTCAAGTTTGTCATCAACTACAAACGT
AAAGGATTTACTCATTTGTTGAGTTCGACGACTGTTTCGGTTGTTCCTCCTCGACATGATGAATATCCGAGATTT
ATTAGTGCGGCTTGGCCTTATTATATGGGTGCTATCAGTACCAGTGTCGGCTTTTTCGTGTTCTCGGCTATTTGG
TTGGGAGGGGAAGTTAAAGCCTTTGATAAGAAAGGAAAAGGTCGGAAGGCTGAATAG
Transcript >AgabiH97|063010
ATGGTCGCCTTCAAACGGCTTTTGTTGCTGGCAGCCGCCTTTGCCTCGTCCTACGCCAAGTCCAGCTCGGGTGAC
TCTGTCCTCGTCATCGTAGAGCCCAAAAAACAAGCAGACTACACCATATTCCTCGATGGGCTTCGAGAAAAAGGC
TATGACTTGACTTTCAGATCTCCTCGCGCAGATGCGCCTCTTCTCACTCAGGACGGCGTTCCCAGTTTCTCCCAT
GTCATCTTCTTTGCTCCCGACACCAAATCCTTCCCAAGCGACATTACACCACAATCTCTTGTCTCTCTCTTGGGC
AGCAAAACTAACCTCCTCATCACGCTTTCCACAAAACAGACATCCCTCACCTCCCTTGCAGCCGAGTTCTCACTC
GCACCTGCACCCCCAGGGACGCCCTTAATATCCTATTTCCCAGAACGATCTGAGCCTCTGAATGTCGTCCCCATT
CAACCTCCATCGACCAGCCAAATCCTCTCTCAAAACATGGCACCAGTATGGTTCTCTGGTACACCATTCGCTCTG
GGTAACAATCCTATGCTTGTACCTATTTTAAATGCACCTCCATATGCATTTGCATCAGAGGTGGATGGCGGTTCG
GCAGACTCGCTTGTGGATGCTGCTGAGAAGGGAGGAGAAGGACTTTGGGCTGGAAGTCGAATGGGAGTCGTTACT
GGATTCCAAACTACCACTGGAGCGCGTGTTGTTTGGGCTGGTGGTGCTGAGCTTTTCAGTGATGAATATGCTAAA
AAACAGATTTCCCAGGGCGTTGAATCTGGTAATAAGCAGTTTGTTCAGGAAGTCGCGTCATGGGCTTTCCAAGAG
TCCCTTGTGTTGCGTATCGACCATACTGAGCATCATAAATTCAATACAACCACGCCTAGTGAACTATATACCACA
AGTGACGAACTCGTCTATACCGCTCAAGTTTCCAGGTTTTATCCCGAACGCGGTGTATGGCAACCCTGTTCGGAT
CTTAAAGATCTTCAGTTAGAATTCACGATGCTCGACCCTCATATTCGTATCGCTCTTCCTCCAGTCGAAGGTAAA
CCCGGAACGTACTCTGTCCAATTCCGCGCTCCAGATCGTCATGGTGTCTTCAAGTTTGTCATCAACTACAAACGT
AAAGGATTTACTCATTTGTTGAGTTCGACGACTGTTTCGGTTGTTCCTCCTCGACATGATGAATATCCGAGATTT
ATTAGTGCGGCTTGGCCTTATTATATGGGTGCTATCAGTACCAGTGTCGGCTTTTTCGTGTTCTCGGCTATTTGG
TTGGGAGGGGAAGTTAAAGCCTTTGATAAGAAAGGAAAAGGTCGGAAGGCTGAATAG
Gene >AgabiH97|063010
ATGGTCGCCTTCAAACGGCTTTTGTTGCTGGCAGCCGCCTTTGCCTCGTCCTACGCCAAGTCCAGCTCGGGTGAC
TCTGTCCTCGTCATCGTAGAGCCCAAAAAACAAGCAGACTACACCATATTCCTCGATGGGCTTCGAGGTCGGTCT
CGCGAGATTCTGTCCACGTGTCTATACTAAGGTGTAACACACACAGAAAAAGGCTATGACTTGACTTTCAGATCT
CCTCGCGCAGATGCGCCTCTTCTCACTCAGGACGGCGTTCCCAGTTTCTCCCATGTCATCTTCTTTGCTCCCGAC
ACCAAATGTCAGTCTGCATATCTTCTGCCGTTTCAACAGTTAACCTACTACGTAAACTTCAGCCTTCCCAAGCGA
CATTACACCACAATCTCTTGTCTCTCTCTTGGGCAGCAAAACTAACCTCCTCATCACGCTTTCCACAAAACAGAC
ATCCCTCACCTCCCTTGCAGCCGAGTTCTCACTCGCACCTGCACCCCCAGGGACGCCCTTAATATCCTATTTCCC
AGAACGATCTGAGCCTCTGAATGTCGTCCCCATTCAACCTCCATCGACCAGCCAAATCCTCTCTCAAAACATGGC
ACCAGTATGGTTCTCTGGTACACCATTCGCTCTGGGTAACAATCCTATGCTTGTACCTATTTTAAATGCACCTCC
ATATGCATTTGCATCAGAGGTGGATGGCGGTTCGGCAGACTCGCTTGTGGATGCTGCTGAGAAGGGAGGAGAAGG
ACTTTGGGCTGGAAGTCGAATGGGAGTCGTTACTGGATTCCAAACTACCACTGGAGCGCGTGTTGTTTGGGCTGG
TGGTGCTGAGCTTTTCAGTGATGAATATGCTAAAAAACAGATTTCCCAGTACGTTCATTTAATCTGCCATAGACG
CCGAGATTGAGATATCACCTTTAGGGGCGTTGAATCTGGTAATAAGCAGTTTGTTCAGGAAGTCGCGTCATGGGC
TTTCCAAGAGTCCCTTGTGTTGCGTATCGACCATACTGAGCATCATAAATTCAATACAACCACGCCTAGTGAACT
ATATACCACAAGTGACGAACTCGTGAGTATTCATACTCCAATATCATTTCAACATACTTACATATGTTGCTAAGG
TCTATACCGCTCAAGTTTCCAGGTTTTATCCCGAACGCGGTGTATGGCAACCCTGTTCGGATCTTAAAGATCTTC
AGTTAGAATTCACGATGCTCGACCCTCATATTCGTATCGCTCTTCCTCCAGTCGAAGGTAAACCCGGAACGTACT
CTGTCCAATTCCGCGCTCCAGATCGTCATGGTGTCTTCAAGTTTGTCATCAACTACAAACGTAAAGGGTATGTTT
TCCCTTCTTTAATAAACAAAAAAGCAAAAAAGACTAATGTATTCTTATTTTTCTTTGAAGATTTACTCATTTGTT
GAGTTCGACGACTGTTTCGGTTGTTCCTCCTCGACATGATGAATATCCGAGATTTATTAGTGCGGCTTGGCCTTA
TTATATGGGTGCTATCAGTACCAGTGTCGGCTTTTTCGTGTTCTCGGCTATTTGGTTGGGAGGGGAAGTTAAAGC
CTTTGATAAGAAAGGAAAAGGTCGGAAGGCTGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail