Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|062960
Gene name
Locationscaffold_3:2475216..2475906
Strand-
Gene length (bp)690
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 2.1E-06 8 81
PF08241 Methyltransf_11 Methyltransferase domain 2.7E-05 10 83

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 0.81 0.03 1.59
Initials Initials knots 2.19 0.57 3.81
Pileal_Stipeal_center Stage I stipe center 0.68 0.00 1.43
Pileal_Stipeal_shell Stage I stipe shell 0.90 0.07 1.74
DIF_stipe_center Stage II stipe center 1.02 0.10 1.94
DIF_stipe_shell Stage II stipe shell 0.61 0.00 1.25
DIF_stipe_skin Stage II stipe skin 0.36 0.00 0.79
DIF_cap_skin Stage II cap skin 0.34 0.00 0.74
DIF_cap_tissue Stage II cap tissue 0.16 0.00 0.44
DIF_gill_tissue Stage II gill tissue 0.87 0.06 1.69
YFB_stipe_center Young fruiting body stipe center 0.56 0.00 1.16
YFB_stipe_shell Young fruiting body stipe shell 1.12 0.13 2.12
YFB_stipe_skin Young fruiting body stipe skin 0.76 0.01 1.52
YFB_cap_skin Young fruiting body cap skin 0.16 0.00 0.42
YFB_cap_tissue Young fruiting body cap tissue 0.00 0.00 0.00
YFB_gill_tissue Young fruiting body gill tissue 0.97 0.08 1.86
YFB_veil Young fruiting body veil 0.73 0.01 1.45

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.955697 no
Casing YFB_stipe_center 0.726079 no
Casing YFB_stipe_shell 0.738969 no
Casing YFB_stipe_skin 0.962244 no
Casing YFB_cap_skin 0.262789 no
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.879521 no
Casing YFB_veil 0.935741 no
Casing Initials 0.104109 no
Casing Pileal_Stipeal_center 0.892019 no
Casing Pileal_Stipeal_shell 0.931990 no
Casing DIF_stipe_center 0.830889 no
Casing DIF_stipe_shell 0.800839 no
Casing DIF_stipe_skin 0.436414 no
Casing DIF_cap_skin 0.386655 no
Casing DIF_cap_tissue 0.192906 no
DIF_gill_tissue YFB_stipe_center 0.649307 no
DIF_gill_tissue YFB_stipe_shell 0.810303 no
DIF_gill_tissue YFB_stipe_skin 0.913186 no
DIF_gill_tissue YFB_cap_skin 0.257577 no
DIF_gill_tissue YFB_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_gill_tissue 0.932677 no
DIF_gill_tissue YFB_veil 0.875116 no
YFB_stipe_center YFB_stipe_shell 0.394192 no
YFB_stipe_center YFB_stipe_skin 0.794677 no
YFB_stipe_center YFB_cap_skin 0.370264 no
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.544060 no
YFB_stipe_center YFB_veil 0.818757 no
YFB_stipe_shell YFB_stipe_skin 0.690086 no
YFB_stipe_shell YFB_cap_skin 0.214821 no
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.898555 no
YFB_stipe_shell YFB_veil 0.630765 no
YFB_stipe_skin YFB_cap_skin 0.297304 no
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.835936 no
YFB_stipe_skin YFB_veil 0.978718 no
YFB_cap_skin YFB_cap_tissue 1.000000 no
YFB_cap_skin YFB_gill_tissue 0.237337 no
YFB_cap_skin YFB_veil 0.299743 no
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.782950 no
Initials DIF_gill_tissue 0.138429 no
Initials YFB_stipe_center 0.045273 yes
Initials YFB_stipe_shell 0.304877 no
Initials YFB_stipe_skin 0.107290 no
Initials YFB_cap_skin 0.172433 no
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.187911 no
Initials YFB_veil 0.081058 no
Initials Pileal_Stipeal_center 0.110231 no
Initials Pileal_Stipeal_shell 0.162495 no
Initials DIF_stipe_center 0.226152 no
Initials DIF_stipe_shell 0.063760 no
Initials DIF_stipe_skin 0.081756 no
Initials DIF_cap_skin 0.077698 no
Initials DIF_cap_tissue 0.119007 no
Pileal_Stipeal_center DIF_gill_tissue 0.830475 no
Pileal_Stipeal_center YFB_stipe_center 0.891627 no
Pileal_Stipeal_center YFB_stipe_shell 0.598279 no
Pileal_Stipeal_center YFB_stipe_skin 0.938595 no
Pileal_Stipeal_center YFB_cap_skin 0.323063 no
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.741955 no
Pileal_Stipeal_center YFB_veil 0.956475 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.811140 no
Pileal_Stipeal_center DIF_stipe_center 0.681752 no
Pileal_Stipeal_center DIF_stipe_shell 0.944064 no
Pileal_Stipeal_center DIF_stipe_skin 0.616840 no
Pileal_Stipeal_center DIF_cap_skin 0.542506 no
Pileal_Stipeal_center DIF_cap_tissue 0.254541 no
Pileal_Stipeal_shell DIF_gill_tissue 0.982120 no
Pileal_Stipeal_shell YFB_stipe_center 0.620193 no
Pileal_Stipeal_shell YFB_stipe_shell 0.841172 no
Pileal_Stipeal_shell YFB_stipe_skin 0.890970 no
Pileal_Stipeal_shell YFB_cap_skin 0.257376 no
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.958391 no
Pileal_Stipeal_shell YFB_veil 0.848415 no
Pileal_Stipeal_shell DIF_stipe_center 0.920651 no
Pileal_Stipeal_shell DIF_stipe_shell 0.696758 no
Pileal_Stipeal_shell DIF_stipe_skin 0.372239 no
Pileal_Stipeal_shell DIF_cap_skin 0.326142 no
Pileal_Stipeal_shell DIF_cap_tissue 0.189160 no
DIF_stipe_center DIF_gill_tissue 0.892457 no
DIF_stipe_center YFB_stipe_center 0.498782 no
DIF_stipe_center YFB_stipe_shell 0.935269 no
DIF_stipe_center YFB_stipe_skin 0.783243 no
DIF_stipe_center YFB_cap_skin 0.233426 no
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.967249 no
DIF_stipe_center YFB_veil 0.734649 no
DIF_stipe_center DIF_stipe_shell 0.580967 no
DIF_stipe_center DIF_stipe_skin 0.304877 no
DIF_stipe_center DIF_cap_skin 0.250478 no
DIF_stipe_center DIF_cap_tissue 0.163972 no
DIF_stipe_shell DIF_gill_tissue 0.734866 no
DIF_stipe_shell YFB_stipe_center 0.949210 no
DIF_stipe_shell YFB_stipe_shell 0.485147 no
DIF_stipe_shell YFB_stipe_skin 0.864534 no
DIF_stipe_shell YFB_cap_skin 0.358404 no
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.631212 no
DIF_stipe_shell YFB_veil 0.885577 no
DIF_stipe_shell DIF_stipe_skin 0.679315 no
DIF_stipe_shell DIF_cap_skin 0.617413 no
DIF_stipe_shell DIF_cap_tissue 0.294735 no
DIF_stipe_skin DIF_gill_tissue 0.395432 no
DIF_stipe_skin YFB_stipe_center 0.752525 no
DIF_stipe_skin YFB_stipe_shell 0.248658 no
DIF_stipe_skin YFB_stipe_skin 0.505049 no
DIF_stipe_skin YFB_cap_skin 1.000000 no
DIF_stipe_skin YFB_cap_tissue 1.000000 no
DIF_stipe_skin YFB_gill_tissue 0.329497 no
DIF_stipe_skin YFB_veil 0.501097 no
DIF_stipe_skin DIF_cap_skin 1.000000 no
DIF_stipe_skin DIF_cap_tissue 1.000000 no
DIF_cap_skin DIF_gill_tissue 0.349987 no
DIF_cap_skin YFB_stipe_center 0.705282 no
DIF_cap_skin YFB_stipe_shell 0.225710 no
DIF_cap_skin YFB_stipe_skin 0.451220 no
DIF_cap_skin YFB_cap_skin 1.000000 no
DIF_cap_skin YFB_cap_tissue 1.000000 no
DIF_cap_skin YFB_gill_tissue 0.286806 no
DIF_cap_skin YFB_veil 0.465106 no
DIF_cap_skin DIF_cap_tissue 1.000000 no
DIF_cap_tissue DIF_gill_tissue 0.182435 no
DIF_cap_tissue YFB_stipe_center 0.301178 no
DIF_cap_tissue YFB_stipe_shell 0.141124 no
DIF_cap_tissue YFB_stipe_skin 0.224708 no
DIF_cap_tissue YFB_cap_skin 1.000000 no
DIF_cap_tissue YFB_cap_tissue 1.000000 no
DIF_cap_tissue YFB_gill_tissue 0.160771 no
DIF_cap_tissue YFB_veil 0.223034 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|062960
MAKVTSTKPQFIGIDIESNFFPRASTLPVNIRFEIQTVLDLPKEWTNKFTLVHQRLLISGLRRHEWEPAVKELYR
VVKPGGWIQMFEMRIWTAGPALAKYWDLLCKFGDDAGLMFRDLAIKLPGFLKQSGFVDIHEDTFGTPLGAWANRD
GVDGKEDILGILQGFKTPILRGGGYGVVGSEAEYDGLLQEISKEVDMTPGSTALWTTFWARKPSANEWDRTNHYN
VYEH*
Coding >AgabiH97|062960
ATGGCTAAAGTAACATCCACGAAACCACAATTCATCGGCATAGATATCGAATCAAATTTCTTCCCACGAGCATCA
ACCCTCCCCGTGAACATTAGATTCGAGATCCAAACCGTCCTCGATCTTCCCAAGGAATGGACAAACAAGTTCACA
CTGGTTCATCAGCGTCTTCTCATCTCGGGTCTCCGCAGACATGAATGGGAACCAGCTGTCAAAGAGCTATATCGA
GTCGTCAAACCAGGTGGATGGATTCAAATGTTCGAAATGCGAATATGGACTGCTGGTCCAGCCCTTGCCAAATAT
TGGGATTTGCTTTGCAAGTTCGGGGATGATGCAGGGTTGATGTTTCGCGACCTCGCCATCAAACTACCGGGTTTT
CTCAAGCAAAGTGGCTTTGTTGATATTCATGAGGACACTTTTGGTACCCCTCTTGGTGCTTGGGCAAATCGGGAC
GGTGTTGATGGCAAAGAGGATATTTTGGGTATTTTGCAAGGATTTAAGACACCGATATTGAGAGGAGGCGGATAT
GGTGTGGTGGGAAGTGAAGCGGAATACGATGGACTACTGCAGGAGATTTCGAAGGAAGTGGATATGACGCCTGGA
TCGACGGCTTTGTGGACGACGTTCTGGGCACGAAAACCATCTGCCAATGAGTGGGATCGTACTAATCATTACAAT
GTATATGAACATTAG
Transcript >AgabiH97|062960
ATGGCTAAAGTAACATCCACGAAACCACAATTCATCGGCATAGATATCGAATCAAATTTCTTCCCACGAGCATCA
ACCCTCCCCGTGAACATTAGATTCGAGATCCAAACCGTCCTCGATCTTCCCAAGGAATGGACAAACAAGTTCACA
CTGGTTCATCAGCGTCTTCTCATCTCGGGTCTCCGCAGACATGAATGGGAACCAGCTGTCAAAGAGCTATATCGA
GTCGTCAAACCAGGTGGATGGATTCAAATGTTCGAAATGCGAATATGGACTGCTGGTCCAGCCCTTGCCAAATAT
TGGGATTTGCTTTGCAAGTTCGGGGATGATGCAGGGTTGATGTTTCGCGACCTCGCCATCAAACTACCGGGTTTT
CTCAAGCAAAGTGGCTTTGTTGATATTCATGAGGACACTTTTGGTACCCCTCTTGGTGCTTGGGCAAATCGGGAC
GGTGTTGATGGCAAAGAGGATATTTTGGGTATTTTGCAAGGATTTAAGACACCGATATTGAGAGGAGGCGGATAT
GGTGTGGTGGGAAGTGAAGCGGAATACGATGGACTACTGCAGGAGATTTCGAAGGAAGTGGATATGACGCCTGGA
TCGACGGCTTTGTGGACGACGTTCTGGGCACGAAAACCATCTGCCAATGAGTGGGATCGTACTAATCATTACAAT
GTATATGAACATTAG
Gene >AgabiH97|062960
ATGGCTAAAGTAACATCCACGAAACCACAATTCATCGGCATAGATATCGAATCAAATTTCTTCCCACGAGCATCA
ACCCTCCCCGTGAACATTAGATTCGAGATCCAAACCGTCCTCGATCTTCCCAAGGAATGGACAAACAAGTTCACA
CTGGTTCATCAGCGTCTTCTCATCTCGGGTCTCCGCAGACATGAATGGGAACCAGCTGTCAAAGAGCTATATCGA
GTCGTCAAACCAGGTGGATGGATTCAAATGTTCGAAATGCGAATATGGACTGCTGGTCCAGCCCTTGCCAAATAT
TGGGATTTGCTTTGCAAGTTCGGGGATGATGCAGGGTTGATGTTTCGCGACCTCGCCATCAAACTACCGGGTTTT
CTCAAGCAAAGTGGCTTTGTTGATATTCATGAGGACACTTTTGGTACCCCTCTTGGTGCTTGGGCAAATCGGGAC
GGTGTTGATGGCAAAGAGGATATTTTGGGTATTTTGCAAGGATTTAAGACACCGATATTGAGAGGAGGCGGATAT
GGTGTGGTGGGAAGTGAAGCGGAATACGATGGACTACTGCAGGAGATTTCGAAGGAAGTGGATATGACGCCTGGA
TCGACGGCTTTGTGGACGACGTTCTGGGCACGAAAACCATCTGCCAATGAGTGGGATCGTACTAATCATTACAAT
GTATATGAACATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail