Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|062860
Gene name
Locationscaffold_3:2455308..2457989
Strand+
Gene length (bp)2681
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13517 FG-GAP_3 FG-GAP-like repeat 7.2E-08 224 286

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RRM4|TIP_PLAYO T-cell immunomodulatory protein homolog OS=Plasmodium yoelii yoelii GN=PY00695 PE=3 SV=1 46 669 6.0E-59
sp|Q8TB96|TIP_HUMAN T-cell immunomodulatory protein OS=Homo sapiens GN=ITFG1 PE=1 SV=1 29 675 9.0E-59
sp|Q8R4E1|TIP_RAT T-cell immunomodulatory protein OS=Rattus norvegicus GN=Itfg1 PE=2 SV=1 26 675 4.0E-57
sp|Q8I3H7|TIP_PLAF7 T-cell immunomodulatory protein homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFE1445c PE=3 SV=1 46 669 8.0E-54
sp|Q99KW9|TIP_MOUSE T-cell immunomodulatory protein OS=Mus musculus GN=Itfg1 PE=1 SV=2 20 675 3.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RRM4|TIP_PLAYO T-cell immunomodulatory protein homolog OS=Plasmodium yoelii yoelii GN=PY00695 PE=3 SV=1 46 669 6.0E-59
sp|Q8TB96|TIP_HUMAN T-cell immunomodulatory protein OS=Homo sapiens GN=ITFG1 PE=1 SV=1 29 675 9.0E-59
sp|Q8R4E1|TIP_RAT T-cell immunomodulatory protein OS=Rattus norvegicus GN=Itfg1 PE=2 SV=1 26 675 4.0E-57
sp|Q8I3H7|TIP_PLAF7 T-cell immunomodulatory protein homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFE1445c PE=3 SV=1 46 669 8.0E-54
sp|Q99KW9|TIP_MOUSE T-cell immunomodulatory protein OS=Mus musculus GN=Itfg1 PE=1 SV=2 20 675 3.0E-53
sp|Q95KC8|TIP_MACFA T-cell immunomodulatory protein (Fragment) OS=Macaca fascicularis GN=ITFG1 PE=2 SV=2 383 675 5.0E-44
sp|P30639|LNKN1_CAEEL Protein linkin OS=Caenorhabditis elegans GN=lnkn-1 PE=2 SV=1 53 675 6.0E-32
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 629 651 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|062860
MLHSSTRWKLLPCLYLISSLTLPTTAIWPFPEKRFHGTALVDAGTLGLGGDQRIVAFGDFSGDQFLDVVSLASDQ
QTLTIYHWNHEDFEYKEGAQFKHSSKVSNIVPGDFTYSGKLDLLVMGQGRNSKEIDMYLYQSIPNKGFDTANPIH
VQTSTSSQPIPLDVNGDLRIDLLGLTPDGGSKLQVWKNIWNSSRTDSPLFDVQSSYLNDSHCQIANPHSNAVVDL
NGDCLADVFLVCDEGRGQKSFQIWLNKKSQGFVLAMQGSLPSGTQSISFADIDRDGTMDMIFTTCKSVSSSGVGS
DCYINIAYNQQLPLCSYTTDSGMKNGVRVCRPPNDLCTADDNFQFNLLDSPDNNAFVRFPVSSLFRDGHKQSLLV
WDTSFDPPIPLSLRLGDANLDGFPDFLAIFASGNDRTPYLAYSKHCASGVAGCDSKGRGRRGWEVAANSGMKALA
NVKDARGVAFLDMDEDGTLDILVQRTGLQDGSKVLFIQNNFYYDAFFLKAIALNGACDSGWCYSANGSDRYHPFG
VSYSGATYKYTVFDTLGHRSAAQIGQLPQTSYHALQTPYSFFGLGRTNNYIENLFVGTTLHAPEHYINMEGVIPN
SRVVILPPADGGESGGTWKRELFLRPGDWIPWVTVTCVIGMVVLAIIVFVLHLNEKREDELERRRISHHINFDAL
*
Coding >AgabiH97|062860
ATGCTGCATTCATCGACACGGTGGAAACTACTTCCTTGTTTGTATCTTATATCAAGTCTAACACTACCAACGACC
GCAATATGGCCATTTCCTGAAAAGCGATTTCACGGAACGGCCCTGGTGGATGCTGGAACGCTTGGTTTGGGTGGA
GATCAAAGAATAGTTGCGTTTGGTGATTTTAGTGGAGACCAATTTTTGGATGTGGTATCACTTGCTTCCGACCAG
CAAACGCTTACAATCTATCACTGGAATCATGAGGATTTCGAGTACAAGGAGGGTGCACAATTCAAACATTCTTCG
AAAGTTTCGAATATCGTCCCGGGAGATTTCACATATTCGGGGAAACTCGATTTACTCGTCATGGGTCAAGGAAGA
AATTCGAAAGAGATTGACATGTATCTCTATCAATCAATACCGAATAAAGGTTTCGATACTGCGAACCCAATACAT
GTTCAAACATCAACGTCGTCGCAACCTATACCCCTGGATGTCAATGGAGATCTCAGGATTGATCTCTTAGGTCTG
ACACCTGATGGAGGAAGTAAGCTTCAGGTTTGGAAAAATATCTGGAATTCGTCGAGGACTGATTCACCGCTCTTT
GATGTGCAATCATCATACCTCAATGACTCCCATTGTCAAATTGCGAACCCTCATAGTAACGCCGTCGTAGACCTT
AATGGTGATTGCTTGGCTGATGTCTTCCTTGTTTGTGATGAGGGCCGCGGACAGAAATCGTTTCAGATCTGGCTC
AACAAAAAGTCTCAAGGATTTGTTCTGGCTATGCAAGGAAGCTTACCATCTGGTACACAAAGTATCTCCTTTGCC
GATATCGACAGAGATGGGACGATGGACATGATATTCACGACATGTAAAAGTGTCTCTTCGAGCGGAGTCGGCTCA
GACTGTTACATTAACATTGCATATAACCAACAACTTCCTCTATGTTCCTACACGACCGACTCTGGCATGAAGAAT
GGTGTACGAGTGTGTAGACCACCGAACGATCTTTGTACCGCCGATGACAACTTTCAATTCAATCTTCTAGACAGT
CCTGACAACAATGCTTTTGTTCGCTTTCCTGTTTCATCTCTTTTCCGTGATGGTCACAAGCAATCCCTGCTTGTT
TGGGATACGAGCTTTGATCCACCCATTCCCCTTTCATTACGCTTAGGCGATGCCAATTTGGACGGCTTTCCCGAT
TTCCTGGCCATCTTTGCCTCAGGCAATGATCGGACACCGTATCTCGCCTATTCCAAGCATTGTGCATCTGGAGTT
GCAGGGTGTGACAGTAAAGGTCGGGGGAGAAGAGGATGGGAGGTTGCTGCGAATTCCGGGATGAAGGCTCTAGCA
AATGTAAAAGACGCAAGGGGTGTGGCGTTTTTGGATATGGATGAAGATGGTACACTTGACATCTTGGTGCAGCGG
ACTGGATTGCAGGATGGGAGCAAGGTTTTGTTTATTCAGAATAACTTTTACTATGATGCCTTTTTCTTAAAGGCA
ATCGCGCTCAATGGTGCCTGTGATAGCGGATGGTGTTATTCTGCTAATGGGTCTGACCGCTACCATCCCTTCGGT
GTCAGCTATTCAGGAGCAACGTACAAGTATACAGTATTCGATACATTAGGACATCGTTCAGCGGCTCAAATCGGC
CAACTTCCTCAAACGTCCTACCACGCGCTTCAAACACCCTACTCATTTTTCGGCCTTGGTCGAACAAACAACTAC
ATCGAGAATCTGTTTGTCGGTACAACACTGCATGCACCCGAACATTATATCAACATGGAAGGTGTAATACCCAAT
TCTCGAGTCGTCATTCTACCACCTGCGGATGGTGGTGAAAGTGGCGGAACATGGAAACGAGAATTGTTTTTGCGG
CCTGGTGATTGGATTCCATGGGTGACTGTTACTTGTGTTATTGGGATGGTTGTTTTGGCGATAATCGTGTTTGTT
TTGCATTTGAATGAGAAGAGAGAAGATGAGTTGGAGCGGAGGCGGATATCACATCATATTAATTTCGATGCTCTC
TAA
Transcript >AgabiH97|062860
ATGCTGCATTCATCGACACGGTGGAAACTACTTCCTTGTTTGTATCTTATATCAAGTCTAACACTACCAACGACC
GCAATATGGCCATTTCCTGAAAAGCGATTTCACGGAACGGCCCTGGTGGATGCTGGAACGCTTGGTTTGGGTGGA
GATCAAAGAATAGTTGCGTTTGGTGATTTTAGTGGAGACCAATTTTTGGATGTGGTATCACTTGCTTCCGACCAG
CAAACGCTTACAATCTATCACTGGAATCATGAGGATTTCGAGTACAAGGAGGGTGCACAATTCAAACATTCTTCG
AAAGTTTCGAATATCGTCCCGGGAGATTTCACATATTCGGGGAAACTCGATTTACTCGTCATGGGTCAAGGAAGA
AATTCGAAAGAGATTGACATGTATCTCTATCAATCAATACCGAATAAAGGTTTCGATACTGCGAACCCAATACAT
GTTCAAACATCAACGTCGTCGCAACCTATACCCCTGGATGTCAATGGAGATCTCAGGATTGATCTCTTAGGTCTG
ACACCTGATGGAGGAAGTAAGCTTCAGGTTTGGAAAAATATCTGGAATTCGTCGAGGACTGATTCACCGCTCTTT
GATGTGCAATCATCATACCTCAATGACTCCCATTGTCAAATTGCGAACCCTCATAGTAACGCCGTCGTAGACCTT
AATGGTGATTGCTTGGCTGATGTCTTCCTTGTTTGTGATGAGGGCCGCGGACAGAAATCGTTTCAGATCTGGCTC
AACAAAAAGTCTCAAGGATTTGTTCTGGCTATGCAAGGAAGCTTACCATCTGGTACACAAAGTATCTCCTTTGCC
GATATCGACAGAGATGGGACGATGGACATGATATTCACGACATGTAAAAGTGTCTCTTCGAGCGGAGTCGGCTCA
GACTGTTACATTAACATTGCATATAACCAACAACTTCCTCTATGTTCCTACACGACCGACTCTGGCATGAAGAAT
GGTGTACGAGTGTGTAGACCACCGAACGATCTTTGTACCGCCGATGACAACTTTCAATTCAATCTTCTAGACAGT
CCTGACAACAATGCTTTTGTTCGCTTTCCTGTTTCATCTCTTTTCCGTGATGGTCACAAGCAATCCCTGCTTGTT
TGGGATACGAGCTTTGATCCACCCATTCCCCTTTCATTACGCTTAGGCGATGCCAATTTGGACGGCTTTCCCGAT
TTCCTGGCCATCTTTGCCTCAGGCAATGATCGGACACCGTATCTCGCCTATTCCAAGCATTGTGCATCTGGAGTT
GCAGGGTGTGACAGTAAAGGTCGGGGGAGAAGAGGATGGGAGGTTGCTGCGAATTCCGGGATGAAGGCTCTAGCA
AATGTAAAAGACGCAAGGGGTGTGGCGTTTTTGGATATGGATGAAGATGGTACACTTGACATCTTGGTGCAGCGG
ACTGGATTGCAGGATGGGAGCAAGGTTTTGTTTATTCAGAATAACTTTTACTATGATGCCTTTTTCTTAAAGGCA
ATCGCGCTCAATGGTGCCTGTGATAGCGGATGGTGTTATTCTGCTAATGGGTCTGACCGCTACCATCCCTTCGGT
GTCAGCTATTCAGGAGCAACGTACAAGTATACAGTATTCGATACATTAGGACATCGTTCAGCGGCTCAAATCGGC
CAACTTCCTCAAACGTCCTACCACGCGCTTCAAACACCCTACTCATTTTTCGGCCTTGGTCGAACAAACAACTAC
ATCGAGAATCTGTTTGTCGGTACAACACTGCATGCACCCGAACATTATATCAACATGGAAGGTGTAATACCCAAT
TCTCGAGTCGTCATTCTACCACCTGCGGATGGTGGTGAAAGTGGCGGAACATGGAAACGAGAATTGTTTTTGCGG
CCTGGTGATTGGATTCCATGGGTGACTGTTACTTGTGTTATTGGGATGGTTGTTTTGGCGATAATCGTGTTTGTT
TTGCATTTGAATGAGAAGAGAGAAGATGAGTTGGAGCGGAGGCGGATATCACATCATATTAATTTCGATGCTCTC
TAA
Gene >AgabiH97|062860
ATGCTGCATTCATCGACACGGTGGAAACTACTTCCTTGTTTGTATCTTATATCAAGTCTAACACTACCAACGACC
GCAATATGGCCATTTCCTGAAAAGCGATTTCACGGAACGGCCCTGGTGGATGCTGGAACGCTTGGTTTGGGTGGA
GATCAAAGAATAGTTGCGTTTGGTGATTTTAGTGGAGACCAATTGTGAGTTCTAGTGAAAGATTTTTGAAGTGAT
TCATAGATTGTTGTTGGTCAACAGTTTGGATGTGGTATCACTTGCTTCCGACCAGCAAACGCTTACAATCTATCA
CTGGAATCATGGTGAGTAATTTGGGGTTATTAATTATGTTCTTCGCTTGACGGACTCGCTTGATTGTCGTAGAGG
ATTTCGAGTACAAGGAGGGTGCACAATTCAAACATTCTTCGAAAGTTTCGAATATCGTCCCGGGAGATTTCACAT
ATTCGGGGAAACTCGATTTACTCGTCATGGGTCAAGGAAGAAATTCGAAAGAGATTGACATGTATCTCTATCAAT
CAATACCGAATAAAGGTTTCGGTACGTGCTGAGTTATGCATATTCTACAATAACCCCGTTAAACGCGTCGTCCAA
AGATACTGCGAACCCAATACATGTTCAAACATCAACGTCGTCGCAACCTATACCCCTGGATGTCAATGGAGATCT
CAGGATTGATCTCTTAGGTCTGACACCTGATGGAGGAAGTAAGCTTCAGGTTTGGAAAAATATCTGGAATTCGTC
GAGGACTGATTCACCGCTCTTTGATGTGTGAGTATTTCACTTTGGTCTCTTAATACCACTCACAAACGTCACGTA
GGCAATCATCATACCTCAATGACTCCCATTGTCAAATTGCGAACCCTCATAGTAACGCCGTCGTAGACCTTAATG
GTGATTGCTTGGCTGGTGTGTACTCATGCGCGGGATGTGATATACTGGCTGTAACCAACGCGTGTTAGATGTCTT
CCTTGTTTGTGATGAGGGCCGCGGACAGAAATCGTTTCAGATCTGGCTCAACAAAAAGTCTCAAGGATTTGTTCT
GGCTATGCAAGGAAGCTTACCATCTGGTACACAAAGTATCTCCTTTGCCGATATCGGTAAGCTCAAGCATCGAGT
TGTTTCATAGATCGTCCACTGACAGCTACACAGACAGAGATGGGACGATGGACATGATATTCACGACATGTAAAA
GTGTCTCTTCGAGCGGAGTCGGCTCAGACTGTTACATTAACATTGCATATAACCAACAACTTCCTCTATGTTCCT
ACACGACCGACTCTGGCATGAAGAATGGTGTACGAGTGTGTAGACCACCGAACGATCTTTGTACCGCCGATGACA
ACTTTCAATTCAATCTTCTAGACAGTCCTGACAACAATGTCAGTTCCCGACTTCAACGTCCTTTCCACACACTCA
TTCAATTATATAGGCTTTTGTTCGCTTTCCTGTTTCATCTCTTTTCCGTGATGGTCACAAGCAATCCCTGCTTGT
TTGGGATACGAGCTTTGATCCACCCATTCCCCTTTCATTACGCTTAGGCGATGCCAATTTGGACGGCTTTCCCGA
TTTCCTGGCCATCTTTGCCTCAGGCAATGATCGGACACCGTATCTCGCCTATTCCAAGCATTGTGCATCTGGAGT
TGCAGGGTGTGACAGTAAAGGTCGGGGGAGAAGAGGATGGGAGGTTGCTGCGAATTCCGGGATGAAGGCTCTAGC
AAATGTAAAAGACGCAAGGGGTGTGGCGTTTTTGGATATGGATGAAGATGTGAGTGATCTTCTGTAAACAATTTT
CTGCACGATGACTAGAGACTCAATGATATGTACAGGGTACACTTGACATCTTGGTGCAGCGGACTGGATTGCAGG
ATGGGAGCAAGGTTTTGTTTATTCAGAATAACTTTTACTATGATGCCTTTTTCTTAAAGGCAATCGGTGCGTTTC
TCTATGAGCCGGGTTTACGAAAAGCTGATGAATCAATATCTTTCCAGCGCTCAATGGTGCCTGTGATAGCGGATG
GTGTTATTCTGCTAATGGGTCTGACCGCTACCATGTAAAACCTTCCCATTGACTGATAGTCGAGTCCGTACTGAT
GGTTCATCGTAGCCCTTCGGTGTCAGCTATTCAGGAGCAACGTACAAGTATACAGTATTCGATACATTAGGACAT
CGTTCAGCGGCTCAAAGTTTGTCTTTGTCACCTCTTATCCTCTCTTGCCGCTAACACATGTTGAACCAATAGTCG
GCCAACTTCCTCAAACGTCCTACCACGCGCTTCAAACACCCTACTCATTTTTCGGCCTTGGTCGAACAAACAACT
ACATCGAGAATCTGTTTGTCGGTACAACACTGCATGCACCCGAACATTATATCAACATGGAAGGTGTAATACCCA
ATTCTCGAGTCGTCATTCTACCACCTGCGGATGGTGGTGAAAGTGGCGGAACATGGAAACGAGAATTGTTTTTGC
GGCCTGGTGATTGGATTCCATGGGTGACTGTTACTTGTGTTATTGGGATGGTTGTTTTGGCGATAATCGTGTTTG
TTTTGCATTTGAATGAGAAGGTGAGTTTGCTATTTTCTTGAGGTTTTTATGATGTGCTAATGATGTGGCAGAGAG
AAGATGAGTTGGAGCGGAGGCGGATATCACATCATATTAATTTCGATGCTCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail