Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|062850
Gene name
Locationscaffold_3:2451610..2455125
Strand+
Gene length (bp)3515
Transcript length (bp)2916
Coding sequence length (bp)2916
Protein length (aa) 972

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 8.5E-38 696 906
PF00005 ABC_tran ABC transporter 4.2E-23 378 531

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 342 906 1.0E-75
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 374 906 3.0E-75
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 374 906 4.0E-75
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 374 906 1.0E-74
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 374 906 2.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 342 906 1.0E-75
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 374 906 3.0E-75
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 374 906 4.0E-75
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 374 906 1.0E-74
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 374 906 2.0E-74
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 374 906 4.0E-73
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 374 906 2.0E-72
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 345 892 3.0E-70
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 23 620 2.0E-69
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 374 936 2.0E-68
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 345 828 5.0E-68
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 330 911 9.0E-65
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 367 932 3.0E-64
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 23 621 1.0E-63
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 346 906 7.0E-63
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 342 908 7.0E-62
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 347 907 9.0E-62
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 345 911 9.0E-62
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 369 910 1.0E-61
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 375 906 1.0E-61
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 371 906 4.0E-61
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 373 906 1.0E-60
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 369 965 2.0E-60
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 369 955 8.0E-60
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 346 906 1.0E-59
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 373 922 1.0E-59
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 347 906 1.0E-59
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 347 906 3.0E-59
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 331 971 6.0E-59
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 375 968 4.0E-58
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 347 906 6.0E-58
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 343 908 7.0E-58
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 343 908 1.0E-57
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 377 906 4.0E-57
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 374 971 5.0E-57
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 343 911 2.0E-56
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 328 971 1.0E-55
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 375 902 3.0E-55
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 375 932 4.0E-55
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 343 897 6.0E-55
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 343 897 2.0E-54
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 342 971 3.0E-54
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 342 971 4.0E-54
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 368 969 1.0E-53
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 199 630 4.0E-52
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 326 955 8.0E-52
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 335 905 2.0E-51
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 325 897 2.0E-51
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 377 906 2.0E-51
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 374 971 1.0E-50
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 356 905 1.0E-50
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 377 939 1.0E-50
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 357 909 2.0E-50
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 377 957 3.0E-50
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 373 904 3.0E-50
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 331 902 4.0E-50
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 377 960 5.0E-50
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 377 960 6.0E-50
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 369 959 7.0E-50
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 374 906 1.0E-49
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 377 955 2.0E-49
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 377 908 2.0E-49
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 372 905 2.0E-49
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 335 902 3.0E-49
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 377 957 5.0E-49
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 366 957 6.0E-49
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 374 906 1.0E-48
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 376 918 1.0E-48
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 335 905 2.0E-48
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 377 939 2.0E-48
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 342 952 4.0E-48
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 377 908 4.0E-48
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 372 908 5.0E-48
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 377 906 6.0E-48
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 372 960 6.0E-48
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 370 904 7.0E-48
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 377 959 1.0E-47
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 377 908 1.0E-47
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 377 908 2.0E-47
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 376 908 2.0E-47
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 377 957 4.0E-47
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 366 902 5.0E-47
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 377 908 5.0E-47
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 347 968 5.0E-47
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 374 971 5.0E-47
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 335 905 7.0E-47
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 371 939 8.0E-47
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 377 957 1.0E-46
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 340 932 4.0E-46
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 377 955 7.0E-46
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 378 902 9.0E-46
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 347 960 9.0E-46
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 349 915 1.0E-45
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 346 902 2.0E-45
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 377 958 3.0E-45
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 377 906 9.0E-45
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 372 905 1.0E-44
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 377 952 3.0E-44
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 377 908 3.0E-44
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 372 908 3.0E-44
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 377 951 5.0E-44
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 364 969 9.0E-44
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 377 906 1.0E-43
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 377 939 1.0E-43
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 377 957 1.0E-43
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 373 958 1.0E-43
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 377 958 4.0E-43
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 376 942 7.0E-43
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 372 951 9.0E-43
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 367 906 1.0E-42
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 364 969 1.0E-42
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 282 902 1.0E-42
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 370 907 2.0E-42
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 377 906 2.0E-42
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 658 957 5.0E-42
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 377 906 5.0E-42
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 372 908 8.0E-42
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 377 957 9.0E-42
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 377 906 1.0E-41
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 343 908 1.0E-41
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 372 952 1.0E-41
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 371 911 1.0E-41
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 370 902 2.0E-41
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 347 628 3.0E-41
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 340 902 3.0E-41
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 362 970 3.0E-41
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 372 951 5.0E-41
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 371 936 5.0E-41
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 377 951 7.0E-41
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 377 918 7.0E-41
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 377 951 8.0E-41
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 369 908 8.0E-41
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 377 928 9.0E-41
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 377 620 1.0E-40
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 339 902 1.0E-40
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 378 906 2.0E-40
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 376 939 3.0E-40
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 373 942 4.0E-40
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 367 906 5.0E-40
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 367 906 6.0E-40
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 375 853 7.0E-40
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 337 816 8.0E-40
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 340 902 1.0E-39
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 377 906 2.0E-39
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 377 909 5.0E-39
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 343 663 5.0E-39
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 376 909 1.0E-38
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 366 929 1.0E-38
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 377 906 2.0E-38
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 377 906 2.0E-38
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 376 957 3.0E-38
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 377 924 3.0E-38
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 340 902 4.0E-38
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 376 907 5.0E-38
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 377 906 7.0E-38
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 366 906 2.0E-37
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 377 909 2.0E-37
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 369 906 2.0E-37
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 376 909 3.0E-37
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 377 952 4.0E-37
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 369 908 5.0E-37
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 377 906 7.0E-37
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 371 906 7.0E-37
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 377 906 8.0E-37
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 375 902 2.0E-36
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 369 906 2.0E-36
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 377 906 3.0E-36
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 351 906 3.0E-36
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 260 897 5.0E-36
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 377 908 2.0E-35
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 373 934 3.0E-35
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 373 906 3.0E-35
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 372 639 3.0E-35
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 377 908 1.0E-34
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 377 906 1.0E-34
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 376 906 1.0E-34
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 369 906 2.0E-34
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 338 885 2.0E-34
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 377 906 4.0E-34
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 369 906 5.0E-34
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 370 906 1.0E-33
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 369 909 2.0E-33
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 377 906 2.0E-33
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 328 782 3.0E-33
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 375 906 3.0E-33
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 377 906 4.0E-33
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 377 906 5.0E-33
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 374 906 7.0E-33
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 377 907 1.0E-32
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 369 970 1.0E-32
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 369 909 2.0E-32
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 376 906 3.0E-32
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 377 907 5.0E-32
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 376 906 5.0E-32
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 375 902 8.0E-32
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 376 906 4.0E-31
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 335 780 6.0E-31
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 335 816 2.0E-30
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 376 906 3.0E-30
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 694 970 2.0E-29
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 377 958 2.0E-29
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 335 780 2.0E-29
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 369 906 3.0E-29
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 377 906 9.0E-29
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 370 906 1.0E-28
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 377 921 2.0E-28
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 346 965 1.0E-27
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 369 906 2.0E-27
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 690 971 2.0E-26
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 374 902 6.0E-26
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 665 970 2.0E-25
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 340 902 5.0E-25
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 372 907 3.0E-24
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 287 901 1.0E-23
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 378 907 2.0E-23
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 347 548 2.0E-23
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 340 902 5.0E-21
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 347 548 8.0E-21
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 374 534 2.0E-19
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 374 534 2.0E-19
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 374 534 2.0E-19
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 711 934 7.0E-19
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 374 534 7.0E-19
sp|Q0ASQ1|PHNC_MARMM Phosphonates import ATP-binding protein PhnC OS=Maricaulis maris (strain MCS10) GN=phnC PE=3 SV=1 374 588 9.0E-19
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 374 534 1.0E-18
sp|Q4KFA2|LOLD_PSEF5 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=lolD PE=3 SV=2 370 583 1.0E-18
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 374 534 5.0E-18
sp|P44656|Y354_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0354 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0354 PE=3 SV=1 375 569 1.0E-17
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 377 588 3.0E-17
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 374 534 3.0E-17
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 377 906 4.0E-17
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 374 548 4.0E-17
sp|Q3K9F9|LOLD_PSEPF Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf0-1) GN=lolD PE=3 SV=2 370 582 5.0E-17
sp|Q31GF5|LOLD_THICR Lipoprotein-releasing system ATP-binding protein LolD OS=Thiomicrospira crunogena (strain XCL-2) GN=lolD PE=3 SV=1 371 583 7.0E-17
sp|Q3KKA1|ZNUC_PSEPF Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf0-1) GN=znuC PE=3 SV=1 375 541 1.0E-16
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 385 608 1.0E-16
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 385 608 1.0E-16
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 385 608 1.0E-16
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 385 608 1.0E-16
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 378 543 2.0E-16
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 378 589 2.0E-16
sp|P0A9U0|YBBA_SHIFL Uncharacterized ABC transporter ATP-binding protein YbbA OS=Shigella flexneri GN=ybbA PE=3 SV=1 370 548 2.0E-16
sp|P0A9T8|YBBA_ECOLI Uncharacterized ABC transporter ATP-binding protein YbbA OS=Escherichia coli (strain K12) GN=ybbA PE=3 SV=1 370 548 2.0E-16
sp|P0A9T9|YBBA_ECO57 Uncharacterized ABC transporter ATP-binding protein YbbA OS=Escherichia coli O157:H7 GN=ybbA PE=3 SV=1 370 548 2.0E-16
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 378 541 2.0E-16
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 373 590 3.0E-16
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 369 548 3.0E-16
sp|P22040|Y415_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0415 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0415 PE=3 SV=2 353 595 4.0E-16
sp|Q2LVM2|LOLD_SYNAS Lipoprotein-releasing system ATP-binding protein LolD OS=Syntrophus aciditrophicus (strain SB) GN=lolD PE=3 SV=1 370 548 4.0E-16
sp|Q8XDV7|PHNC_ECO57 Phosphonates import ATP-binding protein PhnC OS=Escherichia coli O157:H7 GN=phnC PE=3 SV=1 369 599 5.0E-16
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 378 598 5.0E-16
sp|Q8U4K3|WTPC_PYRFU Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1 378 534 5.0E-16
sp|Q8YUV1|PHNC1_NOSS1 Phosphonates import ATP-binding protein PhnC 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=phnC1 PE=3 SV=1 369 589 6.0E-16
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 371 551 7.0E-16
sp|Q0A8P9|LOLD_ALKEH Lipoprotein-releasing system ATP-binding protein LolD OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lolD PE=3 SV=1 370 548 8.0E-16
sp|Q48PV0|ZNUC_PSE14 Zinc import ATP-binding protein ZnuC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=znuC PE=3 SV=1 375 541 9.0E-16
sp|Q4ZU82|PHNC2_PSEU2 Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=phnC2 PE=3 SV=1 373 564 9.0E-16
sp|Q3YUN6|PHNC_SHISS Phosphonates import ATP-binding protein PhnC OS=Shigella sonnei (strain Ss046) GN=phnC PE=3 SV=1 369 599 1.0E-15
sp|Q9WXX8|Y124_THEMA Probable metal transport system ATP-binding protein TM_0124 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0124 PE=3 SV=1 377 581 1.0E-15
sp|Q4KKK4|ZNUC_PSEF5 Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=znuC PE=3 SV=1 375 541 1.0E-15
sp|Q884I3|LOLD_PSESM Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=lolD PE=3 SV=1 376 582 1.0E-15
sp|Q5UW69|PHNC2_HALMA Phosphonates import ATP-binding protein PhnC 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=phnC2 PE=3 SV=1 378 615 1.0E-15
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 374 534 1.0E-15
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 369 588 1.0E-15
sp|Q0T9T7|PHNC_ECOL5 Phosphonates import ATP-binding protein PhnC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=phnC PE=3 SV=1 369 599 1.0E-15
sp|Q48KI4|LOLD_PSE14 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lolD PE=3 SV=1 376 582 1.0E-15
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 376 550 1.0E-15
sp|Q8FAV1|PHNC_ECOL6 Phosphonates import ATP-binding protein PhnC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=phnC PE=3 SV=1 369 599 1.0E-15
sp|Q88KY4|LOLD_PSEPK Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas putida (strain KT2440) GN=lolD PE=3 SV=2 377 583 1.0E-15
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 374 550 2.0E-15
sp|Q4ZV73|LOLD_PSEU2 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lolD PE=3 SV=2 369 582 2.0E-15
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 360 534 2.0E-15
sp|Q8KLG1|NODI_RHIEC Nod factor export ATP-binding protein I OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nodI PE=3 SV=3 365 534 3.0E-15
sp|Q1R3F6|PHNC_ECOUT Phosphonates import ATP-binding protein PhnC OS=Escherichia coli (strain UTI89 / UPEC) GN=phnC PE=3 SV=1 369 599 3.0E-15
sp|Q3B276|LOLD2_CHLL7 Lipoprotein-releasing system ATP-binding protein LolD 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lolD2 PE=3 SV=1 375 548 3.0E-15
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 378 582 3.0E-15
sp|Q38VW6|POTA_LACSS Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=potA PE=3 SV=1 370 621 4.0E-15
sp|Q2W1R8|MODC_MAGSA Molybdenum import ATP-binding protein ModC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=modC PE=3 SV=1 387 588 4.0E-15
sp|P45092|ARTP_HAEIN Arginine transport ATP-binding protein ArtP OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=artP PE=3 SV=1 372 590 4.0E-15
sp|Q8TYV9|Y182_METKA Putative ABC transporter ATP-binding protein MK0182 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0182 PE=3 SV=1 380 551 4.0E-15
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 374 599 4.0E-15
sp|Q5ZT78|LOLD_LEGPH Lipoprotein-releasing system ATP-binding protein LolD OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lolD PE=3 SV=1 377 587 4.0E-15
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 369 549 4.0E-15
sp|P16677|PHNC_ECOLI Phosphonates import ATP-binding protein PhnC OS=Escherichia coli (strain K12) GN=phnC PE=3 SV=2 369 599 4.0E-15
sp|Q5X2Z8|LOLD_LEGPA Lipoprotein-releasing system ATP-binding protein LolD OS=Legionella pneumophila (strain Paris) GN=lolD PE=3 SV=1 377 587 4.0E-15
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 379 551 4.0E-15
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 373 563 5.0E-15
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 374 599 5.0E-15
sp|Q83P97|PHNC_SHIFL Phosphonates import ATP-binding protein PhnC OS=Shigella flexneri GN=phnC PE=3 SV=2 369 599 5.0E-15
sp|Q0SXV5|PHNC_SHIF8 Phosphonates import ATP-binding protein PhnC OS=Shigella flexneri serotype 5b (strain 8401) GN=phnC PE=3 SV=1 369 599 5.0E-15
sp|Q5LUD0|LOLD_RUEPO Lipoprotein-releasing system ATP-binding protein LolD OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lolD PE=3 SV=1 361 583 5.0E-15
sp|Q1BHS6|LOLD_BURCA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia cenocepacia (strain AU 1054) GN=lolD PE=3 SV=1 370 582 5.0E-15
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 371 551 6.0E-15
sp|Q87UN0|ZNUC_PSESM Zinc import ATP-binding protein ZnuC OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=znuC PE=3 SV=1 375 541 6.0E-15
sp|Q4ZZS2|ZNUC_PSEU2 Zinc import ATP-binding protein ZnuC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=znuC PE=3 SV=1 375 541 6.0E-15
sp|Q31TP8|PHNC_SHIBS Phosphonates import ATP-binding protein PhnC OS=Shigella boydii serotype 4 (strain Sb227) GN=phnC PE=3 SV=1 369 599 8.0E-15
sp|Q7W148|PHNC_BORPA Phosphonates import ATP-binding protein PhnC OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=phnC PE=3 SV=1 377 591 8.0E-15
sp|Q48HL2|PHNC2_PSE14 Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=phnC2 PE=3 SV=1 385 564 9.0E-15
sp|Q20ZP0|PHNC1_RHOPB Phosphonates import ATP-binding protein PhnC 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=phnC1 PE=3 SV=1 385 591 9.0E-15
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 378 553 9.0E-15
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 371 545 9.0E-15
sp|Q166X0|PHNC2_ROSDO Phosphonates import ATP-binding protein PhnC 2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=phnC2 PE=3 SV=1 374 588 1.0E-14
sp|Q882S0|PHNC2_PSESM Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=phnC2 PE=3 SV=1 385 640 1.0E-14
sp|O26236|Y133_METTH Putative ABC transporter ATP-binding protein MTH_133 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_133 PE=3 SV=1 378 591 1.0E-14
sp|Q3J7S3|LOLD_NITOC Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lolD PE=3 SV=1 377 582 1.0E-14
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 377 598 1.0E-14
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 378 588 1.0E-14
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 377 615 1.0E-14
sp|Q329I3|PHNC_SHIDS Phosphonates import ATP-binding protein PhnC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=phnC PE=3 SV=1 369 599 1.0E-14
sp|Q21JQ9|LOLD_SACD2 Lipoprotein-releasing system ATP-binding protein LolD OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=lolD PE=3 SV=1 369 549 1.0E-14
sp|Q1IGY7|ZNUC_PSEE4 Zinc import ATP-binding protein ZnuC OS=Pseudomonas entomophila (strain L48) GN=znuC PE=3 SV=1 375 536 1.0E-14
sp|Q6WB63|PHNC_ALCFA Phosphonates import ATP-binding protein PhnC OS=Alcaligenes faecalis GN=phnC PE=3 SV=1 385 563 1.0E-14
sp|Q9HT73|ZNUC_PSEAE Zinc import ATP-binding protein ZnuC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=znuC PE=3 SV=1 375 548 1.0E-14
sp|Q02DK9|ZNUC_PSEAB Zinc import ATP-binding protein ZnuC OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=znuC PE=3 SV=1 375 548 1.0E-14
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 378 553 2.0E-14
sp|Q5WUF8|LOLD_LEGPL Lipoprotein-releasing system ATP-binding protein LolD OS=Legionella pneumophila (strain Lens) GN=lolD PE=3 SV=1 377 587 2.0E-14
sp|Q7WNT8|PHNC_BORBR Phosphonates import ATP-binding protein PhnC OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=phnC PE=3 SV=1 377 591 2.0E-14
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 376 588 2.0E-14
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 366 551 2.0E-14
sp|Q83CV2|LOLD_COXBU Lipoprotein-releasing system ATP-binding protein LolD OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lolD PE=3 SV=1 377 583 2.0E-14
sp|Q39EV3|LOLD_BURL3 Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=lolD PE=3 SV=1 370 582 2.0E-14
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 377 534 2.0E-14
sp|Q87R20|LOLD_VIBPA Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lolD PE=3 SV=1 370 548 2.0E-14
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 366 548 2.0E-14
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 372 548 2.0E-14
sp|Q1LPJ9|LOLD_CUPMC Lipoprotein-releasing system ATP-binding protein LolD OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=lolD PE=3 SV=1 370 583 2.0E-14
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 378 540 2.0E-14
sp|Q217L2|MACB_RHOPB Macrolide export ATP-binding/permease protein MacB OS=Rhodopseudomonas palustris (strain BisB18) GN=macB PE=3 SV=1 385 587 2.0E-14
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 370 545 2.0E-14
sp|Q6N999|LOLD1_RHOPA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lolD1 PE=3 SV=1 374 548 3.0E-14
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 376 588 3.0E-14
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 377 534 3.0E-14
sp|Q88RL1|ZNUC_PSEPK Zinc import ATP-binding protein ZnuC OS=Pseudomonas putida (strain KT2440) GN=znuC PE=3 SV=1 375 536 3.0E-14
sp|Q2S3A3|LOLD_SALRD Lipoprotein-releasing system ATP-binding protein LolD OS=Salinibacter ruber (strain DSM 13855 / M31) GN=lolD PE=3 SV=1 361 594 3.0E-14
sp|Q50801|Y583_METTM Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2 378 588 3.0E-14
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 366 573 3.0E-14
sp|Q28M30|LOLD_JANSC Lipoprotein-releasing system ATP-binding protein LolD OS=Jannaschia sp. (strain CCS1) GN=lolD PE=3 SV=1 366 582 3.0E-14
sp|Q2IXX0|MACB_RHOP2 Macrolide export ATP-binding/permease protein MacB OS=Rhodopseudomonas palustris (strain HaA2) GN=macB PE=3 SV=1 385 578 4.0E-14
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 373 588 4.0E-14
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 378 590 4.0E-14
sp|Q9RZU5|HMUV_DEIRA Hemin import ATP-binding protein HmuV OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hmuV PE=3 SV=1 375 585 4.0E-14
sp|O34814|FTSE_BACSU Cell division ATP-binding protein FtsE OS=Bacillus subtilis (strain 168) GN=ftsE PE=1 SV=1 378 548 4.0E-14
sp|Q7M8M4|PHNC_WOLSU Phosphonates import ATP-binding protein PhnC OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=phnC PE=3 SV=1 374 591 4.0E-14
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 374 551 4.0E-14
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 366 534 4.0E-14
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 376 589 5.0E-14
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 362 553 5.0E-14
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 378 629 5.0E-14
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 369 548 5.0E-14
sp|Q552P3|ABCAB_DICDI ABC transporter A family member 11 OS=Dictyostelium discoideum GN=abcA11 PE=3 SV=1 368 549 5.0E-14
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 372 548 5.0E-14
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 377 578 5.0E-14
sp|Q9HZL7|LOLD_PSEAE Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lolD PE=3 SV=1 387 582 6.0E-14
sp|Q5QU46|LOLD_IDILO Lipoprotein-releasing system ATP-binding protein LolD OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=lolD PE=3 SV=1 371 582 6.0E-14
sp|Q9CM47|MACB_PASMU Macrolide export ATP-binding/permease protein MacB OS=Pasteurella multocida (strain Pm70) GN=macB PE=3 SV=1 371 551 6.0E-14
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 347 534 6.0E-14
sp|Q0A9E2|ZNUC_ALKEH Zinc import ATP-binding protein ZnuC OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=znuC PE=3 SV=1 374 589 6.0E-14
sp|Q11JI6|LOLD_CHESB Lipoprotein-releasing system ATP-binding protein LolD OS=Chelativorans sp. (strain BNC1) GN=lolD PE=3 SV=1 370 585 6.0E-14
sp|Q83LR7|MACB_SHIFL Macrolide export ATP-binding/permease protein MacB OS=Shigella flexneri GN=macB PE=3 SV=1 371 614 6.0E-14
sp|Q98KS7|LOLD_RHILO Lipoprotein-releasing system ATP-binding protein LolD OS=Rhizobium loti (strain MAFF303099) GN=lolD PE=3 SV=2 370 545 6.0E-14
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 333 548 6.0E-14
sp|Q0SRL2|POTA_CLOPS Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain SM101 / Type A) GN=potA PE=3 SV=2 374 618 7.0E-14
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 377 600 7.0E-14
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 378 545 7.0E-14
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 365 583 7.0E-14
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 365 583 7.0E-14
sp|P63374|PSTB1_STRR6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pstB1 PE=3 SV=1 373 566 7.0E-14
sp|P63373|PSTB1_STRPN Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pstB1 PE=3 SV=1 373 566 7.0E-14
sp|Q7NTU0|LOLD_CHRVO Lipoprotein-releasing system ATP-binding protein LolD OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lolD PE=3 SV=1 366 548 8.0E-14
sp|Q9KS33|POTA_VIBCH Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=potA PE=3 SV=1 369 534 8.0E-14
sp|Q6RCE0|PHNC_PSEST Phosphonates import ATP-binding protein PhnC OS=Pseudomonas stutzeri GN=phnC PE=3 SV=1 385 564 8.0E-14
sp|Q82VL9|LOLD_NITEU Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lolD PE=3 SV=1 370 582 8.0E-14
sp|O66646|LOLD_AQUAE Lipoprotein-releasing system ATP-binding protein LolD OS=Aquifex aeolicus (strain VF5) GN=lolD PE=1 SV=1 372 548 9.0E-14
sp|P63368|PSTB1_STRA5 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB1 PE=3 SV=1 387 566 9.0E-14
sp|P63367|PSTB1_STRA3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB1 PE=3 SV=1 387 566 9.0E-14
sp|Q3K199|PSTB1_STRA1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB1 PE=3 SV=2 387 566 9.0E-14
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 371 552 9.0E-14
sp|Q9Z8J5|Y348_CHLPN Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 OS=Chlamydia pneumoniae GN=CPn_0348 PE=3 SV=1 361 581 9.0E-14
sp|Q7NUJ3|MACB_CHRVO Macrolide export ATP-binding/permease protein MacB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=macB PE=3 SV=1 365 605 9.0E-14
sp|Q9CEW8|PSTB1_LACLA Phosphate import ATP-binding protein PstB 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pstB1 PE=3 SV=1 374 566 9.0E-14
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 378 588 9.0E-14
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 376 582 1.0E-13
sp|P45127|ETTA_HAEIN Energy-dependent translational throttle protein EttA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ettA PE=1 SV=1 387 551 1.0E-13
sp|Q2RU16|LOLD1_RHORT Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=lolD1 PE=3 SV=2 375 582 1.0E-13
sp|Q83KR7|ZNUC_SHIFL Zinc import ATP-binding protein ZnuC OS=Shigella flexneri GN=znuC PE=3 SV=1 366 534 1.0E-13
sp|Q0T3U8|ZNUC_SHIF8 Zinc import ATP-binding protein ZnuC OS=Shigella flexneri serotype 5b (strain 8401) GN=znuC PE=3 SV=1 366 534 1.0E-13
sp|Q5LUR8|ZNUC_RUEPO Zinc import ATP-binding protein ZnuC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=znuC PE=3 SV=1 375 551 1.0E-13
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 374 652 1.0E-13
sp|Q8Y0C6|LOLD_RALSO Lipoprotein-releasing system ATP-binding protein LolD OS=Ralstonia solanacearum (strain GMI1000) GN=lolD PE=3 SV=1 370 583 1.0E-13
sp|Q9AB70|PHNC_CAUCR Phosphonates import ATP-binding protein PhnC OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=phnC PE=3 SV=1 366 598 1.0E-13
sp|Q8PY26|Y1038_METMA Putative ABC transporter ATP-binding protein MM_1038 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1038 PE=3 SV=2 374 606 1.0E-13
sp|A0LM36|MACB_SYNFM Macrolide export ATP-binding/permease protein MacB OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=macB PE=3 SV=1 377 566 1.0E-13
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 345 591 1.0E-13
sp|Q8A1M1|LOLD_BACTN Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lolD PE=3 SV=1 366 535 1.0E-13
sp|Q63SP4|LOLD_BURPS Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia pseudomallei (strain K96243) GN=lolD PE=3 SV=2 370 582 1.0E-13
sp|Q62J04|LOLD_BURMA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia mallei (strain ATCC 23344) GN=lolD PE=3 SV=2 370 582 1.0E-13
sp|Q02MI4|MACB_PSEAB Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=macB PE=3 SV=1 351 549 1.0E-13
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 366 574 1.0E-13
sp|Q57855|Y412_METJA Uncharacterized ABC transporter ATP-binding protein MJ0412 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0412 PE=3 SV=1 337 535 1.0E-13
sp|Q16BC5|PHNC1_ROSDO Phosphonates import ATP-binding protein PhnC 1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=phnC1 PE=3 SV=1 385 588 1.0E-13
sp|Q6D664|LOLD_PECAS Lipoprotein-releasing system ATP-binding protein LolD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lolD PE=3 SV=1 377 548 1.0E-13
sp|Q1LQB5|PHNC1_CUPMC Phosphonates import ATP-binding protein PhnC 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=phnC1 PE=3 SV=2 374 588 1.0E-13
sp|Q28VN1|ZNUC_JANSC Zinc import ATP-binding protein ZnuC OS=Jannaschia sp. (strain CCS1) GN=znuC PE=3 SV=1 376 551 1.0E-13
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 375 607 1.0E-13
sp|Q2SXD1|LOLD_BURTA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lolD PE=3 SV=1 370 582 1.0E-13
sp|Q146E7|TAUB1_BURXL Taurine import ATP-binding protein TauB 1 OS=Burkholderia xenovorans (strain LB400) GN=tauB1 PE=3 SV=1 368 537 1.0E-13
sp|Q5E0B3|LOLD_VIBF1 Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=lolD PE=3 SV=1 370 573 1.0E-13
sp|Q9I190|MACB_PSEAE Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=macB PE=3 SV=1 367 549 1.0E-13
sp|Q98KI3|MODC_RHILO Molybdenum import ATP-binding protein ModC OS=Rhizobium loti (strain MAFF303099) GN=modC PE=3 SV=1 380 588 2.0E-13
sp|Q04FM1|ECFA2_OENOB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA2 PE=3 SV=1 384 623 2.0E-13
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 372 545 2.0E-13
sp|Q1B8U4|SSUB_MYCSS Aliphatic sulfonates import ATP-binding protein SsuB OS=Mycobacterium sp. (strain MCS) GN=ssuB PE=3 SV=1 375 548 2.0E-13
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 376 583 2.0E-13
sp|Q9EYM2|LOLD_ACIAD Lipoprotein-releasing system ATP-binding protein LolD OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lolD PE=3 SV=1 377 582 2.0E-13
sp|Q57213|Y1474_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1474 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1474 PE=3 SV=1 374 570 2.0E-13
sp|Q9A9P4|LOLD1_CAUCR Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lolD1 PE=3 SV=1 371 548 2.0E-13
sp|Q58762|WTPC_METJA Molybdate/tungstate import ATP-binding protein WtpC OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wtpC PE=3 SV=1 393 553 2.0E-13
sp|Q74DN5|Y1281_GEOSL Putative ABC transporter ATP-binding protein GSU1281 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1281 PE=3 SV=1 378 553 2.0E-13
sp|Q87JM4|MACB_VIBPA Macrolide export ATP-binding/permease protein MacB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=macB PE=3 SV=1 371 550 2.0E-13
sp|Q0K1N8|PHNC2_CUPNH Phosphonates import ATP-binding protein PhnC 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phnC2 PE=3 SV=1 374 594 2.0E-13
sp|Q9KUI0|CYSA_VIBCH Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysA PE=3 SV=1 378 582 2.0E-13
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 378 547 2.0E-13
sp|O31723|YLMA_BACSU Uncharacterized ABC transporter ATP-binding protein YlmA OS=Bacillus subtilis (strain 168) GN=ylmA PE=2 SV=2 377 588 2.0E-13
sp|Q3ATY5|LOLD1_CHLCH Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Chlorobium chlorochromatii (strain CaD3) GN=lolD1 PE=3 SV=1 375 559 2.0E-13
sp|Q981Y8|SSUB2_RHILO Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Rhizobium loti (strain MAFF303099) GN=ssuB2 PE=3 SV=1 366 582 3.0E-13
sp|Q65T42|CYSA_MANSM Sulfate/thiosulfate import ATP-binding protein CysA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysA PE=3 SV=1 378 583 3.0E-13
sp|A0L0V9|MACB_SHESA Macrolide export ATP-binding/permease protein MacB OS=Shewanella sp. (strain ANA-3) GN=macB PE=3 SV=1 364 578 3.0E-13
sp|Q65UE1|POTA_MANSM Spermidine/putrescine import ATP-binding protein PotA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=potA PE=3 SV=1 369 534 3.0E-13
sp|Q2L0H5|UGPC_BORA1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella avium (strain 197N) GN=ugpC PE=3 SV=1 377 599 3.0E-13
sp|Q8CPN0|POTA_STAES Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=potA PE=3 SV=1 369 548 3.0E-13
sp|Q3SRG8|LOLD_NITWN Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lolD PE=3 SV=1 369 585 3.0E-13
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 370 609 3.0E-13
sp|Q8KF76|LOLD1_CHLTE Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lolD1 PE=3 SV=1 375 541 3.0E-13
sp|Q6LTB1|ZNUC_PHOPR Zinc import ATP-binding protein ZnuC OS=Photobacterium profundum GN=znuC PE=3 SV=1 374 534 3.0E-13
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 362 545 3.0E-13
sp|Q3AKM8|PHNC_SYNSC Phosphonates import ATP-binding protein PhnC OS=Synechococcus sp. (strain CC9605) GN=phnC PE=3 SV=1 366 582 3.0E-13
sp|Q1R0Z6|PHNC_CHRSD Phosphonates import ATP-binding protein PhnC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=phnC PE=3 SV=1 376 589 3.0E-13
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 378 545 3.0E-13
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 377 534 3.0E-13
sp|Q9KD30|MNTB_BACHD Manganese transport system ATP-binding protein MntB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mntB PE=3 SV=1 387 581 3.0E-13
sp|Q8XIZ5|POTA_CLOPE Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain 13 / Type A) GN=potA PE=3 SV=1 374 534 3.0E-13
sp|Q0TNZ3|POTA_CLOP1 Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=potA PE=3 SV=1 374 534 3.0E-13
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 369 655 3.0E-13
sp|Q5M4F2|PSTB2_STRT2 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pstB2 PE=3 SV=1 373 566 4.0E-13
sp|Q5LZU2|PSTB2_STRT1 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pstB2 PE=3 SV=1 373 566 4.0E-13
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 387 548 4.0E-13
sp|Q8PAG0|PSTB_XANCP Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pstB PE=3 SV=1 378 551 4.0E-13
sp|Q4UT63|PSTB_XANC8 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pstB PE=3 SV=1 378 551 4.0E-13
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 366 534 4.0E-13
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 388 582 4.0E-13
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 369 547 4.0E-13
sp|P63363|PSTB1_LISMO Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pstB1 PE=3 SV=1 367 551 4.0E-13
sp|Q71WT3|PSTB1_LISMF Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pstB1 PE=3 SV=1 367 551 4.0E-13
sp|P63364|PSTB1_LISIN Phosphate import ATP-binding protein PstB 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pstB1 PE=3 SV=1 367 551 4.0E-13
sp|Q2EHL8|MACB_AGGAC Macrolide export ATP-binding/permease protein MacB OS=Aggregatibacter actinomycetemcomitans GN=macB PE=1 SV=2 367 567 4.0E-13
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 366 534 5.0E-13
sp|Q8PM59|PSTB_XANAC Phosphate import ATP-binding protein PstB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pstB PE=3 SV=1 378 551 5.0E-13
sp|Q9HYL7|PHNC2_PSEAE Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phnC2 PE=3 SV=1 373 564 5.0E-13
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 364 621 5.0E-13
sp|Q1QLB0|LOLD_NITHX Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lolD PE=3 SV=1 369 585 5.0E-13
sp|Q18KE1|PHNC1_HALWD Phosphonates import ATP-binding protein PhnC 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=phnC1 PE=3 SV=1 372 564 5.0E-13
sp|Q64Z80|LOLD_BACFR Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides fragilis (strain YCH46) GN=lolD PE=3 SV=1 366 535 5.0E-13
sp|Q1CI46|LOLD_YERPN Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lolD PE=3 SV=1 377 548 6.0E-13
sp|Q8ZFR4|LOLD_YERPE Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pestis GN=lolD PE=3 SV=1 377 548 6.0E-13
sp|Q1C6Q8|LOLD_YERPA Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lolD PE=3 SV=1 377 548 6.0E-13
sp|Q3BV68|PSTB_XANC5 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pstB PE=3 SV=2 378 551 6.0E-13
sp|Q02QM1|PHNC1_PSEAB Phosphonates import ATP-binding protein PhnC 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=phnC1 PE=3 SV=1 373 564 6.0E-13
sp|A1RG29|MACB_SHESW Macrolide export ATP-binding/permease protein MacB OS=Shewanella sp. (strain W3-18-1) GN=macB PE=3 SV=1 356 551 6.0E-13
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 368 551 6.0E-13
sp|Q0HVQ0|LOLD_SHESR Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella sp. (strain MR-7) GN=lolD PE=3 SV=2 377 583 6.0E-13
sp|Q5H002|PSTB_XANOR Phosphate import ATP-binding protein PstB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pstB PE=3 SV=2 378 551 6.0E-13
sp|Q2P2Y5|PSTB_XANOM Phosphate import ATP-binding protein PstB OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pstB PE=3 SV=1 378 551 6.0E-13
sp|Q1QX72|LOLD_CHRSD Lipoprotein-releasing system ATP-binding protein LolD OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lolD PE=3 SV=2 370 582 6.0E-13
sp|Q0TJH0|MACB_ECOL5 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=macB PE=3 SV=1 371 608 7.0E-13
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 385 559 7.0E-13
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 378 582 7.0E-13
sp|Q1RE44|MACB_ECOUT Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli (strain UTI89 / UPEC) GN=macB PE=3 SV=1 371 608 7.0E-13
sp|A1A9B7|MACB1_ECOK1 Macrolide export ATP-binding/permease protein MacB 1 OS=Escherichia coli O1:K1 / APEC GN=macB1 PE=3 SV=1 371 608 7.0E-13
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 377 582 7.0E-13
sp|Q74KF8|PSTB2_LACJO Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=pstB2 PE=3 SV=1 378 551 7.0E-13
sp|A1B9K8|ZNUC_PARDP Zinc import ATP-binding protein ZnuC OS=Paracoccus denitrificans (strain Pd 1222) GN=znuC PE=3 SV=1 369 548 7.0E-13
sp|Q8YK28|PHNC3_NOSS1 Phosphonates import ATP-binding protein PhnC 3 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=phnC3 PE=3 SV=1 378 591 7.0E-13
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 378 553 7.0E-13
sp|Q82CD3|SSUB2_STRAW Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ssuB2 PE=3 SV=1 374 548 7.0E-13
sp|Q6LX68|ECFA_METMP Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1 378 588 7.0E-13
sp|Q215F6|LOLD1_RHOPB Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=lolD1 PE=3 SV=1 376 548 7.0E-13
sp|Q1QCN2|LOLD_PSYCK Lipoprotein-releasing system ATP-binding protein LolD OS=Psychrobacter cryohalolentis (strain K5) GN=lolD PE=3 SV=1 377 583 7.0E-13
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 378 589 8.0E-13
sp|Q5GRS1|ZNUC_WOLTR Zinc import ATP-binding protein ZnuC OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=znuC PE=3 SV=1 375 586 8.0E-13
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 333 548 8.0E-13
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 375 582 8.0E-13
sp|Q4UMZ7|LOLD_RICFE Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lolD PE=3 SV=1 369 582 8.0E-13
sp|Q8EIL8|MACB_SHEON Macrolide export ATP-binding/permease protein MacB OS=Shewanella oneidensis (strain MR-1) GN=macB PE=3 SV=1 364 578 9.0E-13
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 373 535 9.0E-13
sp|Q2T4B3|MACB_BURTA Macrolide export ATP-binding/permease protein MacB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=macB PE=3 SV=1 385 548 9.0E-13
sp|Q0BTP1|PSTB_GRABC Phosphate import ATP-binding protein PstB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pstB PE=3 SV=1 371 551 9.0E-13
sp|Q4FTM3|LOLD_PSYA2 Lipoprotein-releasing system ATP-binding protein LolD OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lolD PE=3 SV=1 377 583 9.0E-13
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 333 548 9.0E-13
sp|Q8XED0|MACB_ECO57 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O157:H7 GN=macB PE=3 SV=1 371 614 9.0E-13
sp|P57066|LOLD_VIBCH Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lolD PE=3 SV=1 370 548 9.0E-13
sp|Q8CUY0|PHNC2_OCEIH Phosphonates import ATP-binding protein PhnC 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=phnC2 PE=3 SV=1 366 592 1.0E-12
sp|Q8EEV5|LOLD_SHEON Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella oneidensis (strain MR-1) GN=lolD PE=3 SV=1 377 583 1.0E-12
sp|Q8TI15|Y4342_METAC Putative ABC transporter ATP-binding protein MA_4342 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4342 PE=3 SV=1 374 606 1.0E-12
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 329 549 1.0E-12
sp|Q5NHP2|LOLD_FRATT Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lolD PE=3 SV=1 377 551 1.0E-12
sp|Q0BN75|LOLD_FRATO Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lolD PE=3 SV=1 377 551 1.0E-12
sp|Q2A4V5|LOLD_FRATH Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lolD PE=3 SV=1 377 551 1.0E-12
sp|Q14J44|LOLD_FRAT1 Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lolD PE=3 SV=1 377 551 1.0E-12
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 369 534 1.0E-12
sp|P55662|Y4TH_RHISN Probable amino-acid ABC transporter ATP-binding protein y4tH OS=Rhizobium sp. (strain NGR234) GN=NGR_a01510 PE=3 SV=1 376 551 1.0E-12
sp|P96063|PHNT_SALTY Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phnT PE=2 SV=1 373 535 1.0E-12
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 388 582 1.0E-12
sp|Q5LI72|LOLD_BACFN Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lolD PE=3 SV=1 366 535 1.0E-12
sp|Q2NU23|LOLD_SODGM Lipoprotein-releasing system ATP-binding protein LolD OS=Sodalis glossinidius (strain morsitans) GN=lolD PE=3 SV=1 377 574 1.0E-12
sp|P72335|NODI_RHIS3 Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain N33) GN=nodI PE=3 SV=1 366 534 1.0E-12
sp|Q8Y651|MNTB_LISMO Manganese transport system ATP-binding protein MntB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mntB PE=3 SV=1 374 581 1.0E-12
sp|Q12NL5|LOLD_SHEDO Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lolD PE=3 SV=1 371 583 1.0E-12
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 377 582 1.0E-12
sp|Q0BZD8|PHNC_HYPNA Phosphonates import ATP-binding protein PhnC OS=Hyphomonas neptunium (strain ATCC 15444) GN=phnC PE=3 SV=1 385 610 1.0E-12
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 375 582 1.0E-12
sp|P24693|LPTB_ACIFR Lipopolysaccharide export system ATP-binding protein LptB OS=Acidithiobacillus ferrooxidans GN=lptB PE=3 SV=1 388 548 1.0E-12
sp|Q5FA19|FBPC_NEIG1 Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbpC PE=1 SV=1 369 589 1.0E-12
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 386 548 1.0E-12
sp|Q73P71|PHNC_TREDE Phosphonates import ATP-binding protein PhnC OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=phnC PE=3 SV=1 378 588 1.0E-12
sp|Q0S0Z3|FBPC2_RHOJR Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhodococcus jostii (strain RHA1) GN=fbpC2 PE=3 SV=1 376 583 1.0E-12
sp|Q3Z300|LOLD_SHISS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella sonnei (strain Ss046) GN=lolD PE=3 SV=2 370 574 1.0E-12
sp|Q1RD37|LOLD_ECOUT Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli (strain UTI89 / UPEC) GN=lolD PE=3 SV=1 370 574 1.0E-12
sp|Q8FIM7|LOLD_ECOL6 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lolD PE=3 SV=1 370 574 1.0E-12
sp|Q0TIV6|LOLD_ECOL5 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lolD PE=3 SV=2 370 574 1.0E-12
sp|Q82MV1|SSUB1_STRAW Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ssuB1 PE=3 SV=1 375 548 1.0E-12
sp|A0KMJ3|MACB2_AERHH Macrolide export ATP-binding/permease protein MacB 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=macB2 PE=3 SV=1 371 548 1.0E-12
sp|Q3IL62|LOLD_PSEHT Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=lolD PE=3 SV=1 371 548 1.0E-12
sp|Q8UKE4|MACB_AGRFC Macrolide export ATP-binding/permease protein MacB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=macB PE=3 SV=1 385 582 1.0E-12
sp|P0A9W5|ETTA_SHIFL Energy-dependent translational throttle protein EttA OS=Shigella flexneri GN=ettA PE=3 SV=2 387 551 1.0E-12
sp|P0A9W3|ETTA_ECOLI Energy-dependent translational throttle protein EttA OS=Escherichia coli (strain K12) GN=ettA PE=1 SV=2 387 551 1.0E-12
sp|P0A9W4|ETTA_ECO57 Energy-dependent translational throttle protein EttA OS=Escherichia coli O157:H7 GN=ettA PE=3 SV=2 387 551 1.0E-12
sp|Q66D26|PHNC_YERPS Phosphonates import ATP-binding protein PhnC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=phnC PE=3 SV=1 374 592 1.0E-12
sp|Q1CFV9|PHNC_YERPN Phosphonates import ATP-binding protein PhnC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=phnC PE=3 SV=2 374 592 1.0E-12
sp|Q8ZGU5|PHNC_YERPE Phosphonates import ATP-binding protein PhnC OS=Yersinia pestis GN=phnC PE=3 SV=1 374 592 1.0E-12
sp|Q1C9L0|PHNC_YERPA Phosphonates import ATP-binding protein PhnC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=phnC PE=3 SV=2 374 592 1.0E-12
sp|Q3M5J9|SSUB_ANAVT Aliphatic sulfonates import ATP-binding protein SsuB OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ssuB PE=3 SV=1 372 548 1.0E-12
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 377 582 1.0E-12
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 377 582 1.0E-12
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 385 599 2.0E-12
sp|Q323M3|MACB_SHIBS Macrolide export ATP-binding/permease protein MacB OS=Shigella boydii serotype 4 (strain Sb227) GN=macB PE=3 SV=1 371 614 2.0E-12
sp|P0AAF9|ARTP_SHIFL Arginine transport ATP-binding protein ArtP OS=Shigella flexneri GN=artP PE=3 SV=1 388 591 2.0E-12
sp|P0AAF6|ARTP_ECOLI Arginine transport ATP-binding protein ArtP OS=Escherichia coli (strain K12) GN=artP PE=1 SV=1 388 591 2.0E-12
sp|P0AAF7|ARTP_ECOL6 Arginine transport ATP-binding protein ArtP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=artP PE=3 SV=1 388 591 2.0E-12
sp|P0AAF8|ARTP_ECO57 Arginine transport ATP-binding protein ArtP OS=Escherichia coli O157:H7 GN=artP PE=3 SV=1 388 591 2.0E-12
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 373 535 2.0E-12
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 373 535 2.0E-12
sp|Q3Z3Q4|MACB_SHISS Macrolide export ATP-binding/permease protein MacB OS=Shigella sonnei (strain Ss046) GN=macB PE=3 SV=1 371 614 2.0E-12
sp|Q6MMY0|LOLD_BDEBA Lipoprotein-releasing system ATP-binding protein LolD OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lolD PE=3 SV=1 369 551 2.0E-12
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 378 582 2.0E-12
sp|Q3KJQ7|TAUB_PSEPF Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf0-1) GN=tauB PE=3 SV=1 372 578 2.0E-12
sp|Q32EX7|LOLD_SHIDS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lolD PE=3 SV=2 370 574 2.0E-12
sp|Q9RYZ3|PSTB_DEIRA Phosphate import ATP-binding protein PstB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pstB PE=3 SV=1 372 564 2.0E-12
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 366 534 2.0E-12
sp|Q0HJG0|LOLD_SHESM Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella sp. (strain MR-4) GN=lolD PE=3 SV=2 377 583 2.0E-12
sp|Q3A558|LOLD_PELCD Lipoprotein-releasing system ATP-binding protein LolD OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lolD PE=3 SV=1 371 548 2.0E-12
sp|Q6MPX9|MACB_BDEBA Macrolide export ATP-binding/permease protein MacB OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=macB PE=3 SV=1 371 577 2.0E-12
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 374 549 2.0E-12
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 377 582 2.0E-12
sp|O34392|YTRE_BACSU ABC transporter ATP-binding protein YtrE OS=Bacillus subtilis (strain 168) GN=ytrE PE=2 SV=1 361 548 2.0E-12
sp|Q473H8|LOLD_CUPPJ Lipoprotein-releasing system ATP-binding protein LolD OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=lolD PE=3 SV=1 370 583 2.0E-12
sp|Q20ZS6|LOLD2_RHOPB Lipoprotein-releasing system ATP-binding protein LolD 2 OS=Rhodopseudomonas palustris (strain BisB18) GN=lolD2 PE=3 SV=1 374 548 2.0E-12
sp|Q0SK28|SSUB1_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhodococcus jostii (strain RHA1) GN=ssuB1 PE=3 SV=1 374 584 2.0E-12
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 385 534 2.0E-12
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 378 589 2.0E-12
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 378 589 2.0E-12
sp|Q2LTG0|PSTB_SYNAS Phosphate import ATP-binding protein PstB OS=Syntrophus aciditrophicus (strain SB) GN=pstB PE=3 SV=1 378 551 2.0E-12
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 376 583 2.0E-12
sp|Q8X8E3|LOLD_ECO57 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O157:H7 GN=lolD PE=3 SV=2 370 574 2.0E-12
sp|Q3IWB5|ZNUC_RHOS4 Zinc import ATP-binding protein ZnuC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=znuC PE=3 SV=1 377 548 2.0E-12
sp|O85818|POTA_AGGAC Spermidine/putrescine import ATP-binding protein PotA OS=Aggregatibacter actinomycetemcomitans GN=potA PE=3 SV=1 366 534 2.0E-12
sp|Q2JB14|PHNC_FRASC Phosphonates import ATP-binding protein PhnC OS=Frankia sp. (strain CcI3) GN=phnC PE=3 SV=1 378 564 2.0E-12
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 374 588 2.0E-12
sp|Q399M3|MACB_BURL3 Macrolide export ATP-binding/permease protein MacB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=macB PE=3 SV=1 371 548 2.0E-12
sp|Q0VQQ0|LOLD_ALCBS Lipoprotein-releasing system ATP-binding protein LolD OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=lolD PE=3 SV=2 369 574 2.0E-12
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 385 538 2.0E-11
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 378 537 2.0E-11
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 367 582 3.0E-11
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 373 537 6.0E-11
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 385 551 1.0E-10
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 389 588 1.0E-10
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 374 545 2.0E-10
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 302 537 7.0E-10
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 661 906 1.0E-09
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 385 534 5.0E-09
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 385 534 2.0E-08
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 385 545 6.0E-07
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 385 545 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016020 membrane Yes
GO:0036094 small molecule binding No
GO:0017076 purine nucleotide binding No
GO:0110165 cellular anatomical entity No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0005575 cellular_component No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 304 326 22
2 714 736 22
3 751 770 19
4 801 820 19
5 830 852 22
6 857 879 22
7 945 967 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|062850
MRALWVSFALGAFTWTTTYGQTCENYGSSNGSSCLCPTGFGGSSCSQPACGGNIFQGDQRPLASVSSGFANLTSA
GCSCQTAFSSLDQSGDPTSAFGGQSLGNEDPLVCNTAPRVYAAGQLSCQVNNPTLQAIYPLKSTLNIMRTRQPSL
TPVPNVTAFGDTAEAYAQLFYDGVEQFYCNANSCTQEVDDSDGSAKWHCSNLRCTCRPDTTFCGGVPVSDLTIPI
NGLVGDLDIECGAVDASTNLASCIFKQATLEQLFGPNGLPLDGCTFGECVRQSVIDNGGNLTDTTNDGNENGSSL
NGGVIAGLAVVGGLVLLALLVLLWGLWAQRKARLSGLKDLDRRRVTLEWTNLTYIVPGSYDRTFWSFGSKGGHEQ
TILNALTGRVEPGQMMAILGPSGAGKTTLVEILAGKNKSGTISGQVLTSPSYDLQGPPRIGFVPQQDILPPMLTV
FEALLFAARLRLPESIPDTEKQERAIALLERLGIESIRNARIGDNSGRKSRGISGGEMRRVSIGLELIACPDILI
LDEPTSGLDSVSAARVARVLHEIAHDPVNPIPVIASIHQPSSQLYQQFDTVLLLSQGHTLYSGAGSMAPVEHFNA
TNVAPPYLQGYNVADYLLEVASDPPVSLFDLSSSHKQLPRGSGSNCEVSEKGHSSLNRDGEKKGNSEDLAIMNEQ
AATPHRTNGRTKNMYATTFLTQLQHLSGREWKILRRDKSLFITHTAVASVLGVFCGGLYYQTDTSIAGFQSRVGC
LFFLGALIAFSSLSALYNIVDIRPLFLRERSSAYYSPTSWLLSRFLFDMIPLRLIPTIIVSSITYWMAGLAPHPA
NFFKFLFVLVLYSMAMTLFNFLLGTLFQNGGIAILLSALSALYQMTFAGFFVHLNSIPPVLRWLQWLCPLKYNLE
ALSVNEVGSGLLIQDTLEGVPVNVSASLIMNLLFGFGSNNYYRDILVLFAFIAGFGVGVIGIVWFKVRERR*
Coding >AgabiH97|062850
ATGCGAGCGTTGTGGGTTTCTTTCGCGCTAGGAGCCTTCACCTGGACCACGACTTATGGACAAACTTGCGAAAAC
TATGGATCATCGAACGGATCAAGTTGCCTATGTCCAACAGGATTCGGGGGTTCTTCATGTTCCCAGCCTGCTTGC
GGTGGCAATATTTTTCAAGGAGACCAACGTCCATTAGCATCCGTCTCCTCGGGATTTGCCAACCTTACCAGCGCT
GGCTGCTCGTGCCAGACTGCCTTTTCTTCGCTGGATCAGTCTGGAGACCCAACGTCGGCGTTTGGAGGGCAGTCA
TTAGGGAATGAAGATCCTCTGGTGTGCAACACCGCTCCAAGAGTCTACGCTGCGGGACAACTGAGTTGCCAAGTT
AATAATCCCACCCTTCAAGCCATATACCCACTGAAGTCCACCCTCAACATCATGCGCACTCGCCAACCCAGTTTG
ACGCCTGTGCCAAACGTAACCGCGTTCGGAGATACAGCGGAAGCTTACGCACAGCTGTTCTATGACGGTGTAGAG
CAGTTCTACTGCAACGCAAATTCATGCACTCAAGAAGTCGACGACTCGGACGGTAGTGCCAAGTGGCATTGTAGT
AACCTTCGATGTACTTGTCGCCCAGATACGACTTTTTGTGGCGGCGTACCGGTCAGCGACCTTACCATTCCCATC
AACGGACTGGTTGGCGACCTCGATATCGAATGTGGAGCTGTCGACGCCTCCACCAATCTGGCATCTTGCATATTC
AAACAGGCGACTCTCGAACAGTTGTTTGGTCCTAATGGACTTCCACTTGACGGATGCACATTCGGAGAATGTGTG
AGGCAGAGCGTCATTGACAATGGTGGAAATTTGACGGATACCACAAATGACGGAAATGAGAACGGTTCAAGTCTC
AATGGCGGTGTTATTGCTGGCCTGGCTGTCGTAGGGGGATTGGTTCTCTTGGCTTTGCTTGTACTTCTTTGGGGG
CTTTGGGCACAAAGGAAAGCAAGGCTTTCGGGCTTGAAGGATTTGGACAGGCGAAGGGTCACATTGGAATGGACG
AACCTCACTTACATTGTACCTGGATCTTATGACCGCACTTTCTGGAGCTTTGGGAGCAAAGGTGGACATGAGCAA
ACAATTCTCAATGCCCTCACAGGTCGTGTGGAACCCGGACAAATGATGGCCATTCTGGGACCAAGTGGCGCCGGA
AAGACTACTTTAGTTGAAATTCTAGCGGGGAAGAATAAATCCGGAACAATATCTGGTCAGGTTTTGACCTCACCG
AGTTATGATCTTCAAGGACCTCCTCGGATCGGCTTTGTTCCCCAACAAGACATTTTACCTCCAATGCTAACGGTG
TTCGAAGCGCTTCTCTTTGCAGCGCGTTTGCGACTACCTGAAAGTATACCTGATACGGAGAAGCAAGAACGTGCG
ATTGCATTATTAGAAAGGCTCGGGATCGAAAGTATTAGAAACGCGCGCATTGGGGATAATTCTGGAAGAAAGTCT
CGCGGAATAAGCGGAGGGGAAATGAGGAGAGTCAGTATTGGATTAGAACTCATCGCTTGCCCTGATATTCTAATC
CTTGATGAACCCACTTCTGGACTTGATTCTGTCTCCGCCGCTCGCGTGGCAAGGGTGCTTCATGAAATTGCTCAT
GACCCAGTGAATCCTATACCCGTCATTGCCTCTATCCACCAACCCAGCTCACAGTTATACCAACAATTTGACACC
GTCTTACTTCTCTCTCAAGGACATACCCTCTACTCCGGTGCCGGCTCGATGGCGCCTGTTGAACATTTTAATGCA
ACAAACGTCGCCCCTCCCTACCTCCAAGGCTACAACGTCGCCGACTACCTTTTAGAGGTTGCCAGTGACCCGCCG
GTCAGCCTCTTTGACTTATCATCATCACACAAACAACTTCCACGTGGAAGCGGATCAAATTGTGAAGTATCCGAA
AAAGGACATAGTTCGTTAAACCGCGATGGCGAGAAGAAGGGTAACTCAGAAGATCTGGCCATAATGAACGAACAA
GCTGCTACTCCGCATCGGACGAATGGGAGGACGAAAAATATGTATGCTACTACTTTTTTGACGCAACTCCAGCAT
CTATCAGGAAGAGAATGGAAGATTTTGCGAAGGGACAAGTCGTTGTTCATTACTCATACAGCGGTGGCGAGTGTC
CTTGGCGTTTTTTGTGGTGGTTTATACTACCAGACAGATACTTCTATTGCCGGGTTTCAGTCACGCGTTGGGTGC
CTGTTCTTCTTGGGCGCTCTCATTGCCTTTTCTTCTCTGAGTGCCCTCTACAATATCGTGGACATTCGACCTCTC
TTTCTTCGTGAGCGTTCTAGCGCTTACTATAGTCCAACATCGTGGCTTCTCTCTCGTTTCTTGTTCGATATGATA
CCACTTCGGCTTATACCAACTATAATCGTTTCCTCCATAACTTACTGGATGGCAGGGTTAGCTCCACATCCCGCG
AATTTCTTCAAATTTCTCTTTGTCTTGGTGCTTTACAGTATGGCTATGACGCTTTTCAACTTTTTGCTTGGTACA
TTATTCCAGAATGGGGGCATTGCCATCCTGCTTTCAGCCTTGTCGGCACTATACCAGATGACATTCGCAGGCTTC
TTTGTGCACCTCAACTCTATACCTCCTGTTCTACGGTGGCTACAGTGGTTGTGTCCGCTGAAGTATAACCTCGAG
GCGCTGTCTGTCAATGAAGTTGGCTCTGGTTTGTTGATTCAAGATACACTAGAAGGCGTACCGGTGAACGTTTCG
GCGAGTCTGATCATGAATTTGCTCTTTGGTTTTGGTTCGAATAATTACTATCGCGATATCCTTGTTCTATTTGCT
TTCATTGCTGGCTTCGGTGTTGGTGTCATTGGCATTGTATGGTTCAAAGTTCGAGAAAGACGATGA
Transcript >AgabiH97|062850
ATGCGAGCGTTGTGGGTTTCTTTCGCGCTAGGAGCCTTCACCTGGACCACGACTTATGGACAAACTTGCGAAAAC
TATGGATCATCGAACGGATCAAGTTGCCTATGTCCAACAGGATTCGGGGGTTCTTCATGTTCCCAGCCTGCTTGC
GGTGGCAATATTTTTCAAGGAGACCAACGTCCATTAGCATCCGTCTCCTCGGGATTTGCCAACCTTACCAGCGCT
GGCTGCTCGTGCCAGACTGCCTTTTCTTCGCTGGATCAGTCTGGAGACCCAACGTCGGCGTTTGGAGGGCAGTCA
TTAGGGAATGAAGATCCTCTGGTGTGCAACACCGCTCCAAGAGTCTACGCTGCGGGACAACTGAGTTGCCAAGTT
AATAATCCCACCCTTCAAGCCATATACCCACTGAAGTCCACCCTCAACATCATGCGCACTCGCCAACCCAGTTTG
ACGCCTGTGCCAAACGTAACCGCGTTCGGAGATACAGCGGAAGCTTACGCACAGCTGTTCTATGACGGTGTAGAG
CAGTTCTACTGCAACGCAAATTCATGCACTCAAGAAGTCGACGACTCGGACGGTAGTGCCAAGTGGCATTGTAGT
AACCTTCGATGTACTTGTCGCCCAGATACGACTTTTTGTGGCGGCGTACCGGTCAGCGACCTTACCATTCCCATC
AACGGACTGGTTGGCGACCTCGATATCGAATGTGGAGCTGTCGACGCCTCCACCAATCTGGCATCTTGCATATTC
AAACAGGCGACTCTCGAACAGTTGTTTGGTCCTAATGGACTTCCACTTGACGGATGCACATTCGGAGAATGTGTG
AGGCAGAGCGTCATTGACAATGGTGGAAATTTGACGGATACCACAAATGACGGAAATGAGAACGGTTCAAGTCTC
AATGGCGGTGTTATTGCTGGCCTGGCTGTCGTAGGGGGATTGGTTCTCTTGGCTTTGCTTGTACTTCTTTGGGGG
CTTTGGGCACAAAGGAAAGCAAGGCTTTCGGGCTTGAAGGATTTGGACAGGCGAAGGGTCACATTGGAATGGACG
AACCTCACTTACATTGTACCTGGATCTTATGACCGCACTTTCTGGAGCTTTGGGAGCAAAGGTGGACATGAGCAA
ACAATTCTCAATGCCCTCACAGGTCGTGTGGAACCCGGACAAATGATGGCCATTCTGGGACCAAGTGGCGCCGGA
AAGACTACTTTAGTTGAAATTCTAGCGGGGAAGAATAAATCCGGAACAATATCTGGTCAGGTTTTGACCTCACCG
AGTTATGATCTTCAAGGACCTCCTCGGATCGGCTTTGTTCCCCAACAAGACATTTTACCTCCAATGCTAACGGTG
TTCGAAGCGCTTCTCTTTGCAGCGCGTTTGCGACTACCTGAAAGTATACCTGATACGGAGAAGCAAGAACGTGCG
ATTGCATTATTAGAAAGGCTCGGGATCGAAAGTATTAGAAACGCGCGCATTGGGGATAATTCTGGAAGAAAGTCT
CGCGGAATAAGCGGAGGGGAAATGAGGAGAGTCAGTATTGGATTAGAACTCATCGCTTGCCCTGATATTCTAATC
CTTGATGAACCCACTTCTGGACTTGATTCTGTCTCCGCCGCTCGCGTGGCAAGGGTGCTTCATGAAATTGCTCAT
GACCCAGTGAATCCTATACCCGTCATTGCCTCTATCCACCAACCCAGCTCACAGTTATACCAACAATTTGACACC
GTCTTACTTCTCTCTCAAGGACATACCCTCTACTCCGGTGCCGGCTCGATGGCGCCTGTTGAACATTTTAATGCA
ACAAACGTCGCCCCTCCCTACCTCCAAGGCTACAACGTCGCCGACTACCTTTTAGAGGTTGCCAGTGACCCGCCG
GTCAGCCTCTTTGACTTATCATCATCACACAAACAACTTCCACGTGGAAGCGGATCAAATTGTGAAGTATCCGAA
AAAGGACATAGTTCGTTAAACCGCGATGGCGAGAAGAAGGGTAACTCAGAAGATCTGGCCATAATGAACGAACAA
GCTGCTACTCCGCATCGGACGAATGGGAGGACGAAAAATATGTATGCTACTACTTTTTTGACGCAACTCCAGCAT
CTATCAGGAAGAGAATGGAAGATTTTGCGAAGGGACAAGTCGTTGTTCATTACTCATACAGCGGTGGCGAGTGTC
CTTGGCGTTTTTTGTGGTGGTTTATACTACCAGACAGATACTTCTATTGCCGGGTTTCAGTCACGCGTTGGGTGC
CTGTTCTTCTTGGGCGCTCTCATTGCCTTTTCTTCTCTGAGTGCCCTCTACAATATCGTGGACATTCGACCTCTC
TTTCTTCGTGAGCGTTCTAGCGCTTACTATAGTCCAACATCGTGGCTTCTCTCTCGTTTCTTGTTCGATATGATA
CCACTTCGGCTTATACCAACTATAATCGTTTCCTCCATAACTTACTGGATGGCAGGGTTAGCTCCACATCCCGCG
AATTTCTTCAAATTTCTCTTTGTCTTGGTGCTTTACAGTATGGCTATGACGCTTTTCAACTTTTTGCTTGGTACA
TTATTCCAGAATGGGGGCATTGCCATCCTGCTTTCAGCCTTGTCGGCACTATACCAGATGACATTCGCAGGCTTC
TTTGTGCACCTCAACTCTATACCTCCTGTTCTACGGTGGCTACAGTGGTTGTGTCCGCTGAAGTATAACCTCGAG
GCGCTGTCTGTCAATGAAGTTGGCTCTGGTTTGTTGATTCAAGATACACTAGAAGGCGTACCGGTGAACGTTTCG
GCGAGTCTGATCATGAATTTGCTCTTTGGTTTTGGTTCGAATAATTACTATCGCGATATCCTTGTTCTATTTGCT
TTCATTGCTGGCTTCGGTGTTGGTGTCATTGGCATTGTATGGTTCAAAGTTCGAGAAAGACGATGA
Gene >AgabiH97|062850
ATGCGAGCGTTGTGGGTTTCTTTCGCGCTAGGAGCCTTCACCTGGACCACGACTTATGGACAAACTTGCGAAAAC
TATGGATCATCGAACGGATCAAGTTGCCTATGTCCAACAGGATTCGGGGGTTCTTCATGTTCCCAGCCTGCTTGC
GGTGGCAATATTTTTCAAGGAGACCAACGTCCATTAGCATCCGTCTCCTCGGGATTTGCCAACCTTACCAGCGCT
GGCTGCTCGTGCCAGAGTGGGTGGACCGGGACTGGTTGCAATGTATGCACCAGTTCTAATGACTGTCAAGCTGCC
TTTTCTTCGCTGGATCAGTCTGGAGACCCAACGTCGGCGTTTGGAGGGCAGTCATTAGGGAATGAAGATCCTCTG
GTGTGCAACACCGCTCCAAGAGTCTACGCTGCGGGACAACTGAGTTGCCAAGTTAATGTACGTATCTGGTCATTT
TCTTCGAATGTTTCTCATGAATAAGCTTTAGAATCCCACCCTTCAAGCCATATACCCACTGAAGTCCACCCTCAA
CATCATGCGCACTCGCCAACCCAGTTTGACGCCTGTGCCAAACGTAACCGCGTTCGGAGATACAGCGGAAGCTTA
CGCACAGCTGTTCTATGACGGTGTAGAGCAGTTCTACTGCAACGCAAATTCATGCACTCAAGAAGTCGACGACTC
GGACGGTAGTGCCAAGTGGCATTGTAGTAACCTTCGATGTACTTGTCGCCCAGATACGACTTTTTGTGGCGGCGT
ACCGGTCAGCGACCTTACCATTCCCATCAACGGACTGGTTGGCGACCTCGATATCGAATGTGGAGCTGTCGACGC
CTCCACCAATCTGGCATCTTGCATATTCAAACAGGCGACTCTCGAACAGTTGTTTGGTCCTAATGGACTTCCACT
TGACGGATGCACATTCGGAGAATGTGTGAGGCAGAGCGTCATTGACAATGGTGGAAATTTGACGGATACCACAAA
TGACGGAAATGAGAACGGTTCAAGTCTCAATGGCGGTGTTATTGCTGGCCTGGCTGTCGTAGGGGGATTGGTTCT
CTTGGCTTTGCTTGTACTTCTTTGGGGGCTTTGGGCACAAAGGAAAGCAAGGCTTTCGGGCTTGAAGGATTTGGA
CAGGCGAAGGGTCACATTGGAATGGACGAACCTCACTTACATTGTACCTGGATCTTATGACCGCACTTTCTGGAG
CTTTGGGAGCAAAGGTGGACATGAGCAAACAATTCTCAATGCCCTCACAGGTCGTGTGGAACCCGGACAAATGAT
GGCCATTCTGGGACCAAGTGGCAAGTACCCTGTACCCTTCGACACGTCGCGCTATAGTGTTGCTGACCATGCCAA
TATGTTTTAGGCGCCGGAAAGACTACTTTAGTTGAAATTCTAGCGGGGAAGAATAAATCCGGAACAATATCTGGT
CAGGTTTTGACCTCACCGAGTTATGATCTTCAAGGACCTCCTCGGATCGGCTTTGTTCCCCAACAAGACATTTTA
CCTCCAATGCTAACGGTGTTCGAAGCGCTTCTCTTTGCAGCGCGTTTGCGACTACCTGAAAGTATACCTGATACG
GAGAAGCAAGAACGTGCGATTGCATTATTAGAAAGGCTCGGGATCGAAAGTATTAGAAACGCGCGCATTGGGGAT
AATTCTGGAAGAAAGTCTCGCGGAATAAGCGGAGGGGAAATGAGGAGAGTCAGTATTGGATTAGAACTCATCGCT
TGCCCTGATATTCTAATCCTTGATGAACCCACTTCTGGTCGGTGCTCATTCGTGTAAGTAAGATCGTTACTGACT
TATTTTCTCTAGGACTTGATTCTGTCTCCGCCGCTCGCGTGGCAAGGGTGCTTCATGAAATTGCTCATGACCCAG
TGAATCCTATACCCGTCATTGCCTCTATCCACCAACCCAGGTATGTAGGGCTCTTGAATTTATGTTCAGCAGGTT
TACTGATACCACACCTCAGCTCACAGTTATACCAACAATTTGACACCGTCTTACTTCTCTCTCAAGGACATACCC
TCTACTCCGGTGCCGGCTCGATGGCGCCTGTTGAACATTTTAATGCAACAAACGTCGCCCCTCCCTACCTCCAAG
GCTACAACGTCGCCGACTACCTTTTAGAGGTTGCCAGTGACCCGCCGGTCAGCCTCTTTGACTTATCATCATCAC
ACAAACAACTTCCACGTGGAAGCGGATCAAATTGTGAAGTATCCGAAAAAGGACATAGTTCGTTAAACCGCGATG
GCGAGAAGAAGGGTAACTCAGAAGATCTGGCCATAATGAACGAACAAGCTGCTACTCCGCATCGGACGAATGGGA
GGACGAAAAATATGTATGCTACTACTTTTTTGACGCAACTCCAGCATCTATCAGGAAGAGAATGGAAGATTTTGC
GAAGGTGCTCCTTGTTTGTTCTTTTTCCTTGTGTCCGTCTAACGTGGCGAATCTAGGGACAAGTCGTTGTTCATT
ACTCATACAGCGGTGGCGAGTGTCCTTGGCGTTTTTTGTGGTGAGCATACTCGTTCAGTTCCTGGGATATAACGA
TGCCAAGCCGATTTCCAGGTGGTTTATACTACCAGACAGATACTTCTATTGCCGGGTTTCAGTCACGCGTTGGGT
GCCTGTTCTTCTTGGCAAGTCGACGCTTTCATCTTTCGCGAATGTTGGGAAGTTAATCGATTTCTAGGGCGCTCT
CATTGCCTTTTCTTCTCTGAGTGCCCTCTACAATATCGTGGACATTCGACCTCTCTTTCTTCGTGAGCGTTCTAG
CGCTTACTATAGTCCAACATCGTGGCTTCTCTCTCGTTTCTTGTTCGATATGATACCACTTCGGCTTATACCAAC
TATAATCGTTTCCTCCATGTAAGGCCTATCAAAGTTTTCCACAGGGCGAATCTGAACTGATGAAATGATAGAACT
TACTGGATGGCAGGGTTAGCTCCACATCCCGCGAATTTCTTCAAATTTCTCTTTGTCTTGGTGCTTTACAGTATG
GCTATGACGCTTTTCGTAAGTTATTCATCAGAGTGGAATCCGAGCCTTTTTACTGATATCAGTCCAAATATAGAA
CTTTTTGCTTGGTACATTATTCCAGAATGGGGGCATTGCCATCCTGCTTTCAGCCTTGTCGGCACTATACCAGAT
GACATTCGCAGGCTTCTTTGTGCACCTCAACTCTATACCTCCTGTTCTACGGTGGCTACAGTGGTTGTGTCCGCT
GAAGTATAACCTCGAGGCGCTGTCTGTCAATGAAGTTGGCTCTGGTTTGTTGATTCAAGATACACTAGAAGGCGT
ACCGGTGAACGTTTCGGCGAGTCTGATCATGAATTTGGTATGTCACACATTTTTCCGCGAATTTCTTGAGGATAT
CCGTTGATGAGATTCCATAGCTCTTTGGTTTTGGTTCGAATAATTACTATCGCGATATCCTTGTTCTATTTGCTT
TCATTGCTGGCTTCGGTGTTGGTGTCATTGGCATTGTATGGTTCAAAGTTCGAGAAAGACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail