Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|062840
Gene name
Locationscaffold_3:2451002..2451346
Strand-
Gene length (bp)344
Transcript length (bp)243
Coding sequence length (bp)243
Protein length (aa) 81

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17) 2.1E-21 33 80

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q14061|COX17_HUMAN Cytochrome c oxidase copper chaperone OS=Homo sapiens GN=COX17 PE=1 SV=2 27 80 1.0E-10
sp|P81045|COX17_PIG Cytochrome c oxidase copper chaperone OS=Sus scrofa GN=COX17 PE=1 SV=1 34 80 2.0E-10
sp|Q6J3Q7|COX17_CANLF Cytochrome c oxidase copper chaperone OS=Canis lupus familiaris GN=COX17 PE=3 SV=3 34 80 2.0E-10
sp|P56394|COX17_MOUSE Cytochrome c oxidase copper chaperone OS=Mus musculus GN=Cox17 PE=1 SV=2 34 80 5.0E-10
sp|Q94FT1|CX172_ARATH Cytochrome c oxidase copper chaperone 2 OS=Arabidopsis thaliana GN=COX17-2 PE=3 SV=1 35 80 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q14061|COX17_HUMAN Cytochrome c oxidase copper chaperone OS=Homo sapiens GN=COX17 PE=1 SV=2 27 80 1.0E-10
sp|P81045|COX17_PIG Cytochrome c oxidase copper chaperone OS=Sus scrofa GN=COX17 PE=1 SV=1 34 80 2.0E-10
sp|Q6J3Q7|COX17_CANLF Cytochrome c oxidase copper chaperone OS=Canis lupus familiaris GN=COX17 PE=3 SV=3 34 80 2.0E-10
sp|P56394|COX17_MOUSE Cytochrome c oxidase copper chaperone OS=Mus musculus GN=Cox17 PE=1 SV=2 34 80 5.0E-10
sp|Q94FT1|CX172_ARATH Cytochrome c oxidase copper chaperone 2 OS=Arabidopsis thaliana GN=COX17-2 PE=3 SV=1 35 80 1.0E-08
sp|Q9LJQ9|CX171_ARATH Cytochrome c oxidase copper chaperone 1 OS=Arabidopsis thaliana GN=COX17-1 PE=2 SV=1 37 80 3.0E-07
sp|Q9P7Z7|COX17_SCHPO Cytochrome c oxidase copper chaperone OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox17 PE=3 SV=1 35 80 1.0E-06
sp|Q54ID0|COX17_DICDI Cytochrome c oxidase copper chaperone OS=Dictyostelium discoideum GN=cox17 PE=3 SV=1 35 80 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005758 mitochondrial intermembrane space Yes
GO:0005507 copper ion binding Yes
GO:0016531 copper chaperone activity Yes
GO:0070013 intracellular organelle lumen No
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043233 organelle lumen No
GO:0110165 cellular anatomical entity No
GO:0016530 metallochaperone activity No
GO:0140104 molecular carrier activity No
GO:0031970 organelle envelope lumen No
GO:0031974 membrane-enclosed lumen No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0046872 metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|062840
MLEKVSSWWSGSAPDKKPFDPTDPKQNPLNPEGLKPCCACPQTKSLRDDCFLKYGDAAPEQCKEALQNHLACMRS
LGFKI*
Coding >AgabiH97|062840
ATGCTGGAAAAGGTCTCTTCCTGGTGGTCAGGCTCTGCCCCTGACAAAAAGCCATTTGACCCTACAGATCCGAAA
CAGAATCCTTTAAATCCCGAGGGCCTCAAACCATGTTGCGCATGCCCGCAGACAAAGTCTCTTCGAGATGACTGT
TTCCTGAAATATGGTGACGCGGCCCCCGAGCAATGTAAAGAAGCATTGCAAAATCATTTGGCCTGCATGCGCAGT
CTGGGTTTCAAGATATAG
Transcript >AgabiH97|062840
ATGCTGGAAAAGGTCTCTTCCTGGTGGTCAGGCTCTGCCCCTGACAAAAAGCCATTTGACCCTACAGATCCGAAA
CAGAATCCTTTAAATCCCGAGGGCCTCAAACCATGTTGCGCATGCCCGCAGACAAAGTCTCTTCGAGATGACTGT
TTCCTGAAATATGGTGACGCGGCCCCCGAGCAATGTAAAGAAGCATTGCAAAATCATTTGGCCTGCATGCGCAGT
CTGGGTTTCAAGATATAG
Gene >AgabiH97|062840
ATGCTGGAAAAGGTGAGGGGTGTTTTGTCTGTGAACGTAGTATACTGACTGTTCCCTAGGTCTCTTCCTGGTGGT
CAGGCTCTGCCCCTGACAAAAAGCCATTTGACCCTACAGATCCGAAACAGAATCCTTTAAATCCCGAGGGCCTCA
AACCGTACGCTCCCCTTATCCTTAAGTCTGAACAGCGTCATCTCATTCTCTCTTTTAGATGTTGCGCATGCCCGC
AGACAAAGTCTCTTCGAGATGACTGTTTCCTGAAATATGGTGACGCGGCCCCCGAGCAATGTAAAGAAGCATTGC
AAAATCATTTGGCCTGCATGCGCAGTCTGGGTTTCAAGATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail