Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|062050
Gene name
Locationscaffold_3:2248018..2250982
Strand+
Gene length (bp)2964
Transcript length (bp)2196
Coding sequence length (bp)2196
Protein length (aa) 732

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00581 Rhodanese Rhodanese-like domain 5.0E-09 497 580

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P06652|MPIP_SCHPO M-phase inducer phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc25 PE=1 SV=2 464 628 3.0E-38
sp|P48965|MPIP1_RAT M-phase inducer phosphatase 1 OS=Rattus norvegicus GN=Cdc25a PE=1 SV=1 474 613 2.0E-27
sp|A7MBD1|MPIP1_BOVIN M-phase inducer phosphatase 1 OS=Bos taurus GN=CDC25A PE=2 SV=1 474 613 2.0E-27
sp|P30304|MPIP1_HUMAN M-phase inducer phosphatase 1 OS=Homo sapiens GN=CDC25A PE=1 SV=2 474 613 3.0E-27
sp|P48964|MPIP1_MOUSE M-phase inducer phosphatase 1 OS=Mus musculus GN=Cdc25a PE=2 SV=2 474 613 6.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P06652|MPIP_SCHPO M-phase inducer phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc25 PE=1 SV=2 464 628 3.0E-38
sp|P48965|MPIP1_RAT M-phase inducer phosphatase 1 OS=Rattus norvegicus GN=Cdc25a PE=1 SV=1 474 613 2.0E-27
sp|A7MBD1|MPIP1_BOVIN M-phase inducer phosphatase 1 OS=Bos taurus GN=CDC25A PE=2 SV=1 474 613 2.0E-27
sp|P30304|MPIP1_HUMAN M-phase inducer phosphatase 1 OS=Homo sapiens GN=CDC25A PE=1 SV=2 474 613 3.0E-27
sp|P48964|MPIP1_MOUSE M-phase inducer phosphatase 1 OS=Mus musculus GN=Cdc25a PE=2 SV=2 474 613 6.0E-27
sp|P30303|MPIP_EMENI M-phase inducer phosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimT PE=2 SV=2 472 627 4.0E-26
sp|P48968|MPIP3_MESAU M-phase inducer phosphatase 3 OS=Mesocricetus auratus GN=CDC25C PE=2 SV=1 318 601 2.0E-24
sp|P30308|MPI1A_XENLA M-phase inducer phosphatase 1-A OS=Xenopus laevis GN=cdc25-1-a PE=2 SV=1 474 613 3.0E-23
sp|P30309|MPI1B_XENLA M-phase inducer phosphatase 1-B OS=Xenopus laevis GN=cdc25-1-b PE=2 SV=1 474 613 3.0E-23
sp|P30310|MPIP2_XENLA M-phase inducer phosphatase 2 OS=Xenopus laevis GN=cdc25-2 PE=2 SV=1 474 613 4.0E-23
sp|P30311|MPIP3_XENLA M-phase inducer phosphatase 3 OS=Xenopus laevis GN=cdc25-3 PE=1 SV=1 474 613 4.0E-23
sp|P48967|MPIP3_MOUSE M-phase inducer phosphatase 3 OS=Mus musculus GN=Cdc25c PE=2 SV=2 474 601 9.0E-23
sp|P23748|MPIP_YEAST M-phase inducer phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIH1 PE=1 SV=2 470 614 3.0E-22
sp|Q29029|MPIP3_PIG M-phase inducer phosphatase 3 OS=Sus scrofa GN=CDC25C PE=3 SV=1 474 601 4.0E-22
sp|P30307|MPIP3_HUMAN M-phase inducer phosphatase 3 OS=Homo sapiens GN=CDC25C PE=1 SV=2 474 601 6.0E-22
sp|P48966|MPIP2_RAT M-phase inducer phosphatase 2 OS=Rattus norvegicus GN=Cdc25b PE=1 SV=1 474 613 7.0E-22
sp|A5D7P0|MPIP3_BOVIN M-phase inducer phosphatase 3 OS=Bos taurus GN=CDC25C PE=2 SV=1 474 601 9.0E-22
sp|P30306|MPIP2_MOUSE M-phase inducer phosphatase 2 OS=Mus musculus GN=Cdc25b PE=1 SV=1 474 613 1.0E-21
sp|Q03019|TWINE_DROME Cdc25-like protein phosphatase twine OS=Drosophila melanogaster GN=twe PE=1 SV=2 464 613 1.0E-21
sp|P20483|MPIP_DROME M-phase inducer phosphatase OS=Drosophila melanogaster GN=stg PE=1 SV=2 464 601 1.0E-20
sp|P30305|MPIP2_HUMAN M-phase inducer phosphatase 2 OS=Homo sapiens GN=CDC25B PE=1 SV=2 474 613 1.0E-19
sp|Q54QM6|MPIP_DICDI M-phase inducer phosphatase OS=Dictyostelium discoideum GN=cdc25 PE=1 SV=1 499 598 6.0E-18
sp|P30634|MPIP3_CAEEL M-phase inducer phosphatase cdc-25.3 OS=Caenorhabditis elegans GN=cdc-25.3 PE=3 SV=1 468 614 4.0E-17
sp|O44628|MPIP2_CAEEL M-phase inducer phosphatase cdc-25.2 OS=Caenorhabditis elegans GN=cdc-25.2 PE=3 SV=2 468 603 6.0E-15
sp|O44552|MPIP1_CAEEL M-phase inducer phosphatase cdc-25.1 OS=Caenorhabditis elegans GN=cdc-25.1 PE=3 SV=1 497 651 7.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|062050
MWWFAIVSGLFFRLLFPGETSYISRLRDPQLSTAVFALRLHRAAPSKLFPFAHTRDAREILSSTFEINHMMSFFH
RTTSQPLKPPSGLAPKRSQHFVQREVDDFSASDLEISFASTVSLHSPQKNSVPLTPGRDYAEPMDISPAPQSRNP
LTDSARQKSISRPRAYTSGARLFGNDLSNNSSSHLSSTQSVPLPFDTSDSSNTSSRSTDKCTQRSALSAEWLMNS
HTSGHVVEDPVPVSPTDDAMDVDSSFSMAQETTAPLSFSPVSRTAKSTFDTLFYNTLSPRRSFESPAREPKKRRS
VSPDATRRVDELASSPYFPPSPSEAKLDRMSNGKTTLQGLGAPSLFSKRVRRPIASSMAQPPKTAAFFNAEIEPT
EASPQGVPITEDSSFDGPDQSSPAQAYAKRHQGKTLRRRDGSESLRSITHPSPMAVRDSPGRLMASPVSKYMAPG
LGGFGDNEAHGKILPCHKVTEDGLMRIKPETLHALINGKFEPQIHDYHVIDCRFDYEYNGGHVPGAVNINTTAAV
EELLLGRSLTKPKPAKRAPTFAKHLRAKDRASNNHVYPKIHYPEIYILEGGYCAYFKVFGHRCEPPAYVRMDDPN
HAISRREDLDQFRKVKFGRHKSYAYGEGGNKPSTSTSSSQSQHSQTKRNTVSTSSQMFVAANIARGRRSAPLSTL
AEDANTTAEADDTDTDIGDSPCPPPTKAAMPKGRKLARMPLARAETYGPSRLTLGC*
Coding >AgabiH97|062050
ATGTGGTGGTTCGCAATAGTGTCCGGTCTATTTTTCAGGCTATTGTTTCCTGGGGAAACCTCATATATTTCCAGG
TTACGGGACCCACAATTGTCCACAGCGGTGTTTGCGCTTCGACTACATCGTGCGGCTCCCTCCAAGTTGTTTCCC
TTCGCCCATACAAGAGACGCACGAGAAATTCTAAGCAGCACATTTGAAATCAACCACATGATGTCTTTTTTTCAT
CGAACAACGAGTCAACCTCTCAAGCCGCCTTCAGGTCTTGCCCCCAAACGCAGTCAACATTTTGTTCAACGCGAA
GTTGACGACTTTTCTGCTTCGGATTTAGAAATTTCGTTCGCGTCAACTGTTTCGCTTCATTCGCCTCAGAAAAAT
TCTGTCCCTCTTACTCCGGGTCGTGATTATGCCGAGCCCATGGATATTTCACCTGCCCCGCAGTCTAGAAATCCT
CTTACTGACTCTGCACGTCAGAAATCTATTTCTCGTCCCCGTGCATACACGAGCGGCGCCAGACTCTTTGGAAAT
GATCTCAGCAATAATTCATCAAGTCATTTATCAAGCACTCAGAGTGTCCCCCTGCCGTTTGATACATCAGATTCG
TCAAATACATCTTCTCGCTCAACAGATAAATGCACGCAGCGTTCTGCCTTGTCTGCTGAATGGCTTATGAATTCT
CATACCTCTGGCCACGTGGTAGAGGATCCTGTACCAGTTTCTCCCACCGATGACGCTATGGACGTTGACTCGTCA
TTTTCTATGGCGCAGGAAACCACTGCTCCTCTGTCATTTTCGCCAGTCTCCCGTACAGCCAAGTCGACATTCGAC
ACTCTATTTTATAACACTTTATCTCCTCGCAGGTCGTTCGAATCTCCAGCTCGTGAACCCAAGAAACGTCGCTCT
GTCTCTCCAGATGCTACGCGCCGAGTTGACGAATTAGCATCTTCGCCATACTTTCCTCCTTCGCCATCCGAAGCG
AAACTTGACCGTATGAGCAATGGGAAAACAACGCTGCAGGGCCTCGGTGCCCCATCCCTATTTTCGAAACGCGTT
CGCCGACCTATTGCCTCCTCCATGGCTCAACCCCCCAAAACAGCTGCGTTCTTCAATGCTGAGATCGAACCCACT
GAAGCCAGTCCCCAAGGTGTTCCTATTACGGAGGATTCCTCATTCGATGGTCCCGATCAGTCCTCGCCTGCGCAA
GCTTACGCCAAGAGACATCAAGGTAAAACGCTCCGACGCCGCGATGGTTCAGAAAGCTTGAGGTCTATCACTCAT
CCTTCCCCAATGGCGGTACGAGATAGCCCGGGCCGGCTCATGGCTAGTCCGGTGTCCAAATACATGGCTCCCGGC
TTGGGGGGATTTGGTGACAATGAGGCTCATGGCAAAATTTTGCCTTGCCACAAGGTCACCGAAGACGGCCTCATG
CGTATCAAGCCTGAAACTCTCCACGCCCTTATTAATGGCAAATTTGAGCCACAGATACATGATTATCATGTTATC
GACTGCCGATTTGACTATGAATATAACGGCGGACACGTCCCTGGAGCTGTCAATATTAATACCACTGCTGCTGTC
GAAGAATTGCTCCTTGGGCGAAGTCTGACCAAGCCGAAGCCTGCCAAACGGGCACCTACCTTTGCGAAACATCTA
CGCGCCAAAGACCGCGCTTCAAATAATCACGTATATCCCAAAATCCATTATCCAGAGATCTATATTCTTGAAGGG
GGCTACTGTGCTTATTTCAAGGTGTTTGGCCACCGCTGCGAACCACCTGCTTATGTGAGGATGGATGACCCTAAC
CATGCGATTTCGCGCAGAGAAGATTTGGATCAATTTCGTAAAGTCAAGTTTGGAAGGCATAAATCCTATGCATAT
GGCGAAGGCGGCAATAAGCCGTCCACGAGTACCAGCTCTTCCCAGTCTCAACATTCTCAAACGAAGCGCAACACT
GTGTCGACTTCTTCCCAAATGTTCGTTGCAGCAAACATTGCCCGCGGTCGTCGCTCTGCTCCTCTATCAACTCTA
GCGGAGGACGCGAATACGACTGCCGAAGCTGATGACACCGACACGGATATCGGCGACAGCCCTTGCCCCCCACCC
ACGAAGGCCGCCATGCCCAAGGGAAGGAAACTGGCTCGCATGCCGTTAGCGAGGGCTGAGACATATGGACCAAGC
CGTCTCACGCTCGGTTGTTGA
Transcript >AgabiH97|062050
ATGTGGTGGTTCGCAATAGTGTCCGGTCTATTTTTCAGGCTATTGTTTCCTGGGGAAACCTCATATATTTCCAGG
TTACGGGACCCACAATTGTCCACAGCGGTGTTTGCGCTTCGACTACATCGTGCGGCTCCCTCCAAGTTGTTTCCC
TTCGCCCATACAAGAGACGCACGAGAAATTCTAAGCAGCACATTTGAAATCAACCACATGATGTCTTTTTTTCAT
CGAACAACGAGTCAACCTCTCAAGCCGCCTTCAGGTCTTGCCCCCAAACGCAGTCAACATTTTGTTCAACGCGAA
GTTGACGACTTTTCTGCTTCGGATTTAGAAATTTCGTTCGCGTCAACTGTTTCGCTTCATTCGCCTCAGAAAAAT
TCTGTCCCTCTTACTCCGGGTCGTGATTATGCCGAGCCCATGGATATTTCACCTGCCCCGCAGTCTAGAAATCCT
CTTACTGACTCTGCACGTCAGAAATCTATTTCTCGTCCCCGTGCATACACGAGCGGCGCCAGACTCTTTGGAAAT
GATCTCAGCAATAATTCATCAAGTCATTTATCAAGCACTCAGAGTGTCCCCCTGCCGTTTGATACATCAGATTCG
TCAAATACATCTTCTCGCTCAACAGATAAATGCACGCAGCGTTCTGCCTTGTCTGCTGAATGGCTTATGAATTCT
CATACCTCTGGCCACGTGGTAGAGGATCCTGTACCAGTTTCTCCCACCGATGACGCTATGGACGTTGACTCGTCA
TTTTCTATGGCGCAGGAAACCACTGCTCCTCTGTCATTTTCGCCAGTCTCCCGTACAGCCAAGTCGACATTCGAC
ACTCTATTTTATAACACTTTATCTCCTCGCAGGTCGTTCGAATCTCCAGCTCGTGAACCCAAGAAACGTCGCTCT
GTCTCTCCAGATGCTACGCGCCGAGTTGACGAATTAGCATCTTCGCCATACTTTCCTCCTTCGCCATCCGAAGCG
AAACTTGACCGTATGAGCAATGGGAAAACAACGCTGCAGGGCCTCGGTGCCCCATCCCTATTTTCGAAACGCGTT
CGCCGACCTATTGCCTCCTCCATGGCTCAACCCCCCAAAACAGCTGCGTTCTTCAATGCTGAGATCGAACCCACT
GAAGCCAGTCCCCAAGGTGTTCCTATTACGGAGGATTCCTCATTCGATGGTCCCGATCAGTCCTCGCCTGCGCAA
GCTTACGCCAAGAGACATCAAGGTAAAACGCTCCGACGCCGCGATGGTTCAGAAAGCTTGAGGTCTATCACTCAT
CCTTCCCCAATGGCGGTACGAGATAGCCCGGGCCGGCTCATGGCTAGTCCGGTGTCCAAATACATGGCTCCCGGC
TTGGGGGGATTTGGTGACAATGAGGCTCATGGCAAAATTTTGCCTTGCCACAAGGTCACCGAAGACGGCCTCATG
CGTATCAAGCCTGAAACTCTCCACGCCCTTATTAATGGCAAATTTGAGCCACAGATACATGATTATCATGTTATC
GACTGCCGATTTGACTATGAATATAACGGCGGACACGTCCCTGGAGCTGTCAATATTAATACCACTGCTGCTGTC
GAAGAATTGCTCCTTGGGCGAAGTCTGACCAAGCCGAAGCCTGCCAAACGGGCACCTACCTTTGCGAAACATCTA
CGCGCCAAAGACCGCGCTTCAAATAATCACGTATATCCCAAAATCCATTATCCAGAGATCTATATTCTTGAAGGG
GGCTACTGTGCTTATTTCAAGGTGTTTGGCCACCGCTGCGAACCACCTGCTTATGTGAGGATGGATGACCCTAAC
CATGCGATTTCGCGCAGAGAAGATTTGGATCAATTTCGTAAAGTCAAGTTTGGAAGGCATAAATCCTATGCATAT
GGCGAAGGCGGCAATAAGCCGTCCACGAGTACCAGCTCTTCCCAGTCTCAACATTCTCAAACGAAGCGCAACACT
GTGTCGACTTCTTCCCAAATGTTCGTTGCAGCAAACATTGCCCGCGGTCGTCGCTCTGCTCCTCTATCAACTCTA
GCGGAGGACGCGAATACGACTGCCGAAGCTGATGACACCGACACGGATATCGGCGACAGCCCTTGCCCCCCACCC
ACGAAGGCCGCCATGCCCAAGGGAAGGAAACTGGCTCGCATGCCGTTAGCGAGGGCTGAGACATATGGACCAAGC
CGTCTCACGCTCGGTTGTTGA
Gene >AgabiH97|062050
ATGTGGTAAATTAGTCCTGCTTCCACATCTTCCACACGCTGTAGCCACGCGCTCGTAAGGTGGTTCGCAATAGTG
TCCGGTCTATTTTTCAGGCTATTGTTTCCTGGGGAAACCTCATATATTTCCAGTGAGTATTCGCTTTCCTATCAG
ATTAATTATACCTAACCGTTGTGCAGGGTTACGGGACCCACAATTGTCCACAGCGGTGTTTGCGCTTCGACTACA
TCGTGAGAACTTCGCGTCTTGTCACCTTTTTAGCGCCTAAATTACCTATTACTTCCACTTGTTCCAGGTGCGGCT
CCCTCCGTTTGCACATTCGTTAGATCCTAGGTAGGTACTAGGTCTTGGTCCAAACTTGTGAACTCTTGTATCTTC
GGATCCACTCCACTTCATGGTTTATCTGGTTGAACAAGTGTCCTTATGAGCGCACAATAGCCGCTAATGTTCAAC
TTTCCACGTTGTTTCTCCTATCATTTCACAAAACTGATCTCTACCGTTTACCATTCAGCCGCTTCATTTGTCGTT
TTTCAACAAGCCGTATTCGTTATCTAGAAGTTGGTTTGTCGTGCTGTTCCCCCAATCATATGAACCAAAACTCAA
TGTTTCTCGTTTACTTCCGCGACATGGTCATCATGTTTAGTTTCCCTTCGCCCATACAAGAGACGCACGAGAAAT
TCTAAGCAGCACATTTGAAATCAACCACATGATGTCTTTTTTTCATCGAACAACGAGTCAACCTCTCAAGCCGCC
TTCAGGTCTTGCCCCCAAACGCAGTCAACATTTTGTTCAACGCGAAGTTGACGACTTTTCTGCTTCGGATTTAGA
AATTTCGTTCGCGTCAACTGTTTCGCTTCATTCGCCTCAGAAAAATTCTGTCCCTCTTACTCCGGGTCGTGATTA
TGCCGAGCCCATGGATATTTCACCTGCCCCGCAGTCTAGAAATCCTCTTACTGACTCTGCACGTCAGAAATCTAT
TTCTCGTCCCCGTGCATACACGAGCGGCGCCAGACTCTTTGGAAATGATCTCAGCAATAATTCATCAAGTCATTT
ATCAAGCACTCAGAGTGTCCCCCTGCCGTTTGATACATCAGATTCGTCAAATACATCTTCTCGCTCAACAGATAA
ATGCACGCAGCGTTCTGCCTTGTCTGCTGAATGGCTTATGAATTCTCATACCTCTGGCCACGTGGTAGAGGCACG
TAACATTTGTAAATTCCAGCTTACAATGAATTGACAAAATTTGGATGTAACAGGATCCTGTACCAGTTTCTCCCA
CCGATGACGCTATGGACGTTGACTCGTCATTTTCTATGGCGCAGGAAACCACTGCTCCTCTGTCATTTTCGCCAG
TCTCCCGTACAGCCAAGTCGACATTCGACACTCTATTTTATAACACTTTATCTCCTCGCAGGTCGTTCGAATCTC
CAGCTCGTGAACCCAAGAAACGTCGCTCTGTCTCTCCAGATGCTACGCGCCGAGTTGACGAATTAGCATCTTCGC
CATACTTTCCTCCTTCGCCATCCGAAGCGAAACTTGACCGTATGAGCAATGGGAAAACAACGCTGCAGGGCCTCG
GTGCCCCATCCCTATTTTCGAAACGCGTTCGCCGACCTATTGCCTCCTCCATGGCTCAACCCCCCAAAACAGCTG
CGTTCTTCAATGCTGAGATCGAACCCACTGAAGCCAGTCCCCAAGGTGTTCCTGTCCGTCGAGCATTCTCTGCCC
TTTTACCTCCCTCATTGGCCTCGGACCAGATTACGGAGGATTCCTCATTCGATGGTCCCGATCAGTCCTCGCCTG
CGCAAGCTTACGCCAAGAGACATCAAGGTAAAACGCTCCGACGCCGCGATGGTTCAGAAAGCTTGAGGTCTATCA
CTCATCCTTCCCCAATGGCGGTACGAGATAGCCCGGGCCGGCTCATGGCTAGTCCGGTGTCCAAATACATGGCTC
CCGGCTTGGGGGGATTTGGTGACAATGAGGCTCATGGCAAAATTTTGCCTTGCCACAAGGTCACCGAAGACGGCC
TCATGCGTATCAAGCCTGAAACTGTACGTTCCATTGTCACCGTGTTGACTCGGTTATTTCAACAACCTCTTTAGC
TCCACGCCCTTATTAATGGCAAATTTGAGCCACAGATACATGATTATCATGTTATCGACTGCCGATTTGACTATG
AATATAACGGCGGACACGTCCCTGGAGCTGTCAATATTAATACCACTGCTGCTGTCGAAGAATTGCTCCTTGGGC
GAAGTCTGACCAAGCCGAAGCCGTCAGTCAGTGGTGACACAGTGAGGAAAACAATCCTTGTTTTCCATTGTGAGT
TTAGTGCCAAACGGGCACCTACCTTGTGAGTTGTGCTTGTAAACTCCAGCAGCCGCCATTCACCAACGTCATTCT
TTCAGTGCGAAACATCTACGCGCCAAAGACCGCGCTTCAAATAATCACGTATATCCCAAAATCCATTATCCAGAG
ATCTATATTCTTGAAGGGGGCTACTGTGCTTATTTCAAGGTGTTTGGCCACCGCTGCGAACCACCTGCTTATGTG
AGGATGGATGACCCTAACCATGCGATTTCGCGCAGAGAAGATTTGGATCAATTTCGTAAAGTCAAGTTTGGAAGG
CATAAATCCTATGCATATGGCGAAGGCGGCAATAAGCCGTCCACGAGTACCAGCTCTTCCCAGTCTCAACATTCT
CAAACGAAGCGCAACACTGTGTCGACTTCTTCCCAAATGTTCGTTGCAGCAAACATTGCCCGCGGTCGTCGCTCT
GCTCCTCTATCAACTCTAGCGGAGGACGCGAATACGACTGCCGAAGCTGATGACACCGACACGGATATCGGCGAC
AGCCCTTGCCCCCCACCCACGAAGGCCGCCATGCCCAAGGGAAGGAAACTGGCTCGCATGCCGTTAGCGAGGGCT
GAGACATATGGACCAAGCCGTCTCACGCTCGGTTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail