Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|061960
Gene name
Locationscaffold_3:2222596..2223895
Strand-
Gene length (bp)1299
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation 1.3E-37 215 318
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 1.9E-09 81 150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7Y7|P5CR_SCHPO Pyrroline-5-carboxylate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pro3 PE=3 SV=1 5 320 1.0E-75
sp|Q12740|P5CR_ZALAR Pyrroline-5-carboxylate reductase OS=Zalerion arboricola GN=P5CR PE=2 SV=1 4 320 2.0E-72
sp|P32263|P5CR_YEAST Pyrroline-5-carboxylate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRO3 PE=1 SV=1 1 323 1.0E-48
sp|Q6CR99|P5CR_KLULA Pyrroline-5-carboxylate reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRO3 PE=1 SV=1 3 320 8.0E-48
sp|Q12641|P5CR_NEUCR Pyrroline-5-carboxylate reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pro-1 PE=3 SV=2 72 298 1.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7Y7|P5CR_SCHPO Pyrroline-5-carboxylate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pro3 PE=3 SV=1 5 320 1.0E-75
sp|Q12740|P5CR_ZALAR Pyrroline-5-carboxylate reductase OS=Zalerion arboricola GN=P5CR PE=2 SV=1 4 320 2.0E-72
sp|P32263|P5CR_YEAST Pyrroline-5-carboxylate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRO3 PE=1 SV=1 1 323 1.0E-48
sp|Q6CR99|P5CR_KLULA Pyrroline-5-carboxylate reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRO3 PE=1 SV=1 3 320 8.0E-48
sp|Q12641|P5CR_NEUCR Pyrroline-5-carboxylate reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pro-1 PE=3 SV=2 72 298 1.0E-44
sp|P54904|P5CR1_ARATH Pyrroline-5-carboxylate reductase OS=Arabidopsis thaliana GN=PROC1 PE=2 SV=1 109 320 4.0E-44
sp|O04016|P5CR_ACTCH Pyrroline-5-carboxylate reductase OS=Actinidia chinensis PE=2 SV=1 106 318 1.0E-43
sp|P17817|P5CR_SOYBN Pyrroline-5-carboxylate reductase OS=Glycine max PE=2 SV=1 107 318 2.0E-43
sp|Q5RAQ3|P5CR2_PONAB Pyrroline-5-carboxylate reductase 2 OS=Pongo abelii GN=PYCR2 PE=2 SV=1 103 318 3.0E-43
sp|Q96C36|P5CR2_HUMAN Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens GN=PYCR2 PE=1 SV=1 103 318 4.0E-42
sp|Q17QJ7|P5CR2_BOVIN Pyrroline-5-carboxylate reductase 2 OS=Bos taurus GN=PYCR2 PE=2 SV=1 103 318 5.0E-42
sp|Q4R6W7|P5CR2_MACFA Pyrroline-5-carboxylate reductase 2 OS=Macaca fascicularis GN=PYCR2 PE=2 SV=1 103 318 1.0E-41
sp|Q5R9X6|P5CR1_PONAB Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Pongo abelii GN=PYCR1 PE=2 SV=1 107 318 1.0E-41
sp|P32322|P5CR1_HUMAN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens GN=PYCR1 PE=1 SV=2 107 318 1.0E-41
sp|Q6AY23|P5CR2_RAT Pyrroline-5-carboxylate reductase 2 OS=Rattus norvegicus GN=Pycr2 PE=2 SV=1 103 318 2.0E-41
sp|Q922Q4|P5CR2_MOUSE Pyrroline-5-carboxylate reductase 2 OS=Mus musculus GN=Pycr2 PE=1 SV=1 103 318 2.0E-41
sp|Q922W5|P5CR1_MOUSE Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Mus musculus GN=Pycr1 PE=1 SV=1 107 318 3.0E-41
sp|Q58DT4|P5CR1_BOVIN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Bos taurus GN=PYCR1 PE=2 SV=1 103 318 3.0E-41
sp|Q9HH99|P5CR_METAC Pyrroline-5-carboxylate reductase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=proC PE=3 SV=1 107 320 7.0E-40
sp|Q04708|P5CR_PEA Pyrroline-5-carboxylate reductase OS=Pisum sativum GN=PROC PE=2 SV=1 107 318 8.0E-40
sp|Q53H96|P5CR3_HUMAN Pyrroline-5-carboxylate reductase 3 OS=Homo sapiens GN=PYCRL PE=1 SV=3 107 320 1.0E-39
sp|P74572|P5CR_SYNY3 Pyrroline-5-carboxylate reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=proC PE=3 SV=1 107 320 9.0E-39
sp|Q4R531|P5CR3_MACFA Pyrroline-5-carboxylate reductase 3 OS=Macaca fascicularis GN=PYCRL PE=2 SV=1 142 320 9.0E-38
sp|Q58D08|P5CR3_BOVIN Pyrroline-5-carboxylate reductase 3 OS=Bos taurus GN=PYCRL PE=2 SV=1 107 320 5.0E-35
sp|Q9DCC4|P5CR3_MOUSE Pyrroline-5-carboxylate reductase 3 OS=Mus musculus GN=Pycrl PE=1 SV=2 107 320 2.0E-34
sp|A1L2Q8|P5CR3_XENLA Pyrroline-5-carboxylate reductase 3 OS=Xenopus laevis GN=pycrl PE=2 SV=2 107 320 3.0E-34
sp|Q5PQJ6|P5CR3_RAT Pyrroline-5-carboxylate reductase 3 OS=Rattus norvegicus GN=Pycrl PE=2 SV=1 107 320 1.0E-33
sp|P0A9L9|P5CR_SHIFL Pyrroline-5-carboxylate reductase OS=Shigella flexneri GN=proC PE=3 SV=1 104 320 7.0E-33
sp|P0A9L8|P5CR_ECOLI Pyrroline-5-carboxylate reductase OS=Escherichia coli (strain K12) GN=proC PE=1 SV=1 104 320 7.0E-33
sp|Q5SPD7|P5CR3_DANRE Pyrroline-5-carboxylate reductase 3 OS=Danio rerio GN=pycrl PE=2 SV=1 107 324 3.0E-32
sp|P0C1E5|P5CR_CORML Pyrroline-5-carboxylate reductase OS=Corynebacterium melassecola GN=proC PE=3 SV=1 107 320 5.0E-31
sp|P0C1E4|P5CR_CORGL Pyrroline-5-carboxylate reductase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=proC PE=3 SV=1 107 320 6.0E-31
sp|P46725|P5CR_MYCLE Pyrroline-5-carboxylate reductase OS=Mycobacterium leprae (strain TN) GN=proC PE=3 SV=1 97 318 2.0E-30
sp|P54552|P5CR2_BACSU Pyrroline-5-carboxylate reductase 2 OS=Bacillus subtilis (strain 168) GN=proI PE=3 SV=1 113 322 2.0E-29
sp|O66553|P5CR_AQUAE Pyrroline-5-carboxylate reductase OS=Aquifex aeolicus (strain VF5) GN=proC PE=3 SV=1 73 318 1.0E-26
sp|P22008|P5CR_PSEAE Pyrroline-5-carboxylate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=proC PE=1 SV=2 107 320 1.0E-26
sp|P27771|P5CR_TREPA Pyrroline-5-carboxylate reductase OS=Treponema pallidum (strain Nichols) GN=proC PE=1 SV=2 111 311 1.0E-26
sp|P43869|P5CR_HAEIN Pyrroline-5-carboxylate reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=proC PE=3 SV=1 88 318 3.0E-26
sp|Q20848|P5CR_CAEEL Putative pyrroline-5-carboxylate reductase OS=Caenorhabditis elegans GN=F55G1.9 PE=3 SV=1 116 320 1.0E-25
sp|P54893|P5CR_THET2 Pyrroline-5-carboxylate reductase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=proC PE=3 SV=1 145 320 2.0E-25
sp|P9WHU7|P5CR_MYCTU Pyrroline-5-carboxylate reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=proC PE=1 SV=1 97 318 2.0E-25
sp|P9WHU6|P5CR_MYCTO Pyrroline-5-carboxylate reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=proC PE=3 SV=1 97 318 2.0E-25
sp|Q54IL7|P5CR1_DICDI Pyrroline-5-carboxylate reductase 1 OS=Dictyostelium discoideum GN=pycr1 PE=3 SV=1 107 318 3.0E-24
sp|Q55E34|P5CR2_DICDI Pyrroline-5-carboxylate reductase 2 OS=Dictyostelium discoideum GN=pycr2 PE=3 SV=1 107 317 2.0E-22
sp|P52053|P5CR_VIBAL Pyrroline-5-carboxylate reductase OS=Vibrio alginolyticus GN=proC PE=3 SV=1 107 318 2.0E-22
sp|P0CI77|P5CR1_BACSU Pyrroline-5-carboxylate reductase 1 OS=Bacillus subtilis (strain 168) GN=proH PE=3 SV=1 76 320 1.0E-21
sp|E0TY11|P5CR1_BACPZ Pyrroline-5-carboxylate reductase 1 OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=proH PE=3 SV=2 76 318 5.0E-19
sp|Q9CPE8|P5CR_PASMU Pyrroline-5-carboxylate reductase OS=Pasteurella multocida (strain Pm70) GN=proC PE=3 SV=1 110 318 8.0E-19
sp|Q9ZK56|P5CR_HELPJ Pyrroline-5-carboxylate reductase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=proC PE=3 SV=1 102 314 9.0E-18
sp|Q4L6K3|P5CR_STAHJ Pyrroline-5-carboxylate reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=proC PE=3 SV=1 111 320 4.0E-17
sp|Q8CP51|P5CR_STAES Pyrroline-5-carboxylate reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=proC PE=3 SV=1 111 320 6.0E-17
sp|Q5HP48|P5CR_STAEQ Pyrroline-5-carboxylate reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=proC PE=3 SV=1 111 320 6.0E-17
sp|O25773|P5CR_HELPY Pyrroline-5-carboxylate reductase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=proC PE=3 SV=1 93 314 1.0E-16
sp|Q49XV0|P5CR_STAS1 Pyrroline-5-carboxylate reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=proC PE=3 SV=1 111 318 2.0E-15
sp|Q6GGJ5|P5CR_STAAR Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain MRSA252) GN=proC PE=3 SV=1 111 318 2.0E-14
sp|Q5HFR9|P5CR_STAAC Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain COL) GN=proC PE=3 SV=1 111 318 2.0E-14
sp|Q7A0U1|P5CR_STAAW Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain MW2) GN=proC PE=3 SV=1 111 318 2.0E-14
sp|Q6G961|P5CR_STAAS Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain MSSA476) GN=proC PE=3 SV=1 111 318 2.0E-14
sp|Q7A5G8|P5CR_STAAN Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain N315) GN=proC PE=1 SV=1 111 318 2.0E-14
sp|Q99TZ0|P5CR_STAAM Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=proC PE=3 SV=1 111 318 2.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 83.28 41.74 124.81
Initials Initials knots 125.78 73.56 178.00
Pileal_Stipeal_center Stage I stipe center 425.87 203.86 647.88
Pileal_Stipeal_shell Stage I stipe shell 48.52 24.50 72.54
DIF_stipe_center Stage II stipe center 237.26 140.74 333.78
DIF_stipe_shell Stage II stipe shell 422.73 236.10 609.36
DIF_stipe_skin Stage II stipe skin 495.24 275.42 715.06
DIF_cap_skin Stage II cap skin 16.41 7.35 25.48
DIF_cap_tissue Stage II cap tissue 34.01 17.44 50.57
DIF_gill_tissue Stage II gill tissue 32.58 17.70 47.47
YFB_stipe_center Young fruiting body stipe center 1043.56 381.83 1705.29
YFB_stipe_shell Young fruiting body stipe shell 664.36 281.75 1046.97
YFB_stipe_skin Young fruiting body stipe skin 706.10 362.36 1049.84
YFB_cap_skin Young fruiting body cap skin 29.81 16.08 43.54
YFB_cap_tissue Young fruiting body cap tissue 15.61 7.60 23.63
YFB_gill_tissue Young fruiting body gill tissue 62.63 36.61 88.65
YFB_veil Young fruiting body veil 51.09 25.50 76.67

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.001140 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.450181 no
Casing YFB_veil 0.167625 no
Casing Initials 0.216874 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.109622 no
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.004160 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.874320 no
DIF_gill_tissue YFB_cap_tissue 0.026461 yes
DIF_gill_tissue YFB_gill_tissue 0.021583 yes
DIF_gill_tissue YFB_veil 0.200916 no
YFB_stipe_center YFB_stipe_shell 0.371318 no
YFB_stipe_center YFB_stipe_skin 0.409458 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.932632 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.056170 no
YFB_cap_skin YFB_gill_tissue 0.006387 yes
YFB_cap_skin YFB_veil 0.105067 no
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.639933 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.007439 yes
Initials YFB_veil 0.002084 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.018066 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_stipe_center 0.023676 yes
Pileal_Stipeal_center YFB_stipe_shell 0.300784 no
Pileal_Stipeal_center YFB_stipe_skin 0.161964 no
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_veil 0.000613 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.063570 no
Pileal_Stipeal_center DIF_stipe_shell 0.990269 no
Pileal_Stipeal_center DIF_stipe_skin 0.765703 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.267865 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.147277 no
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.521616 no
Pileal_Stipeal_shell YFB_veil 0.937312 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_tissue 0.375198 no
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.000613 yes
DIF_stipe_center YFB_stipe_shell 0.003765 yes
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.000613 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.037593 yes
DIF_stipe_center DIF_stipe_skin 0.006387 yes
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.021322 yes
DIF_stipe_shell YFB_stipe_shell 0.257577 no
DIF_stipe_shell YFB_stipe_skin 0.126023 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.728626 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.062610 no
DIF_stipe_skin YFB_stipe_shell 0.514080 no
DIF_stipe_skin YFB_stipe_skin 0.335960 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_veil 0.000613 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.042909 yes
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.081756 no
DIF_cap_skin YFB_cap_tissue 0.943830 no
DIF_cap_skin YFB_gill_tissue 0.000613 yes
DIF_cap_skin YFB_veil 0.000613 yes
DIF_cap_skin DIF_cap_tissue 0.032742 yes
DIF_cap_tissue DIF_gill_tissue 0.946949 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.807156 no
DIF_cap_tissue YFB_cap_tissue 0.023676 yes
DIF_cap_tissue YFB_gill_tissue 0.054375 no
DIF_cap_tissue YFB_veil 0.300118 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|061960
MGYTLCVLGCGTMGIAILSGVLDSLDTSKHSLTNGTNGTKGTNGTNGVHKWEAHTPGTVSPVGPPDVSTPTRFIA
CVSREATAKKLVSLFASMGEAASNVEVLALKNVQAVKQADVVLLCCKPPVAEKILSEQGMGDVLQGKLLISILAG
VTISQLTDWVPPSTRVVRAMPNTPCKIREGMTVVTTLPPSPNEESDDVIILKIFSSIGRCRYLDEKHFDAATALA
GSGPAIACVLLDAMADGGVMMGLSRSAALELAAQTFQGAARMVLQNAHPAQIKDAVCTPGGCTIAGLLALEDGRV
RSTIARGIQAATERAGELGQFSKK*
Coding >AgabiH97|061960
ATGGGCTACACTCTTTGTGTTTTAGGATGTGGTACTATGGGCATTGCCATTCTATCTGGCGTGCTCGACTCCCTT
GATACTTCTAAACATTCTCTCACCAACGGCACCAACGGCACCAAAGGTACCAATGGTACCAATGGTGTTCACAAG
TGGGAGGCGCATACCCCTGGCACAGTTTCACCAGTTGGTCCGCCGGATGTTTCGACCCCTACACGCTTCATTGCT
TGCGTGAGCCGTGAAGCGACGGCGAAAAAACTAGTCAGCCTATTCGCAAGTATGGGCGAAGCAGCTAGTAACGTC
GAGGTTCTCGCATTAAAAAATGTCCAGGCCGTTAAGCAGGCTGACGTTGTTCTCCTCTGCTGCAAGCCTCCAGTC
GCTGAGAAGATCCTCAGTGAACAGGGAATGGGCGATGTTCTGCAGGGCAAACTCCTTATCAGTATCCTCGCAGGT
GTAACCATTTCCCAACTCACGGACTGGGTACCCCCTTCAACACGGGTGGTCCGTGCTATGCCGAATACCCCTTGC
AAAATTCGCGAAGGAATGACTGTCGTCACCACTTTACCACCCTCGCCGAATGAGGAAAGCGACGACGTCATCATT
CTAAAAATATTTTCTTCCATTGGAAGATGTCGTTACCTTGATGAGAAACACTTTGATGCGGCTACGGCATTGGCT
GGGTCTGGACCTGCTATCGCATGTGTTTTGCTTGACGCCATGGCGGATGGCGGTGTAATGATGGGCTTGTCCAGA
AGCGCAGCCTTGGAGCTCGCCGCTCAAACCTTTCAGGGCGCCGCTCGCATGGTGTTGCAAAATGCCCACCCCGCA
CAGATCAAAGATGCAGTTTGCACCCCTGGAGGATGTACAATTGCTGGGCTTTTGGCTCTTGAAGACGGTCGAGTG
CGCTCCACCATTGCTCGTGGTATTCAAGCAGCCACAGAGAGGGCCGGCGAGCTCGGCCAATTCTCGAAAAAATGA
Transcript >AgabiH97|061960
ATGGGCTACACTCTTTGTGTTTTAGGATGTGGTACTATGGGCATTGCCATTCTATCTGGCGTGCTCGACTCCCTT
GATACTTCTAAACATTCTCTCACCAACGGCACCAACGGCACCAAAGGTACCAATGGTACCAATGGTGTTCACAAG
TGGGAGGCGCATACCCCTGGCACAGTTTCACCAGTTGGTCCGCCGGATGTTTCGACCCCTACACGCTTCATTGCT
TGCGTGAGCCGTGAAGCGACGGCGAAAAAACTAGTCAGCCTATTCGCAAGTATGGGCGAAGCAGCTAGTAACGTC
GAGGTTCTCGCATTAAAAAATGTCCAGGCCGTTAAGCAGGCTGACGTTGTTCTCCTCTGCTGCAAGCCTCCAGTC
GCTGAGAAGATCCTCAGTGAACAGGGAATGGGCGATGTTCTGCAGGGCAAACTCCTTATCAGTATCCTCGCAGGT
GTAACCATTTCCCAACTCACGGACTGGGTACCCCCTTCAACACGGGTGGTCCGTGCTATGCCGAATACCCCTTGC
AAAATTCGCGAAGGAATGACTGTCGTCACCACTTTACCACCCTCGCCGAATGAGGAAAGCGACGACGTCATCATT
CTAAAAATATTTTCTTCCATTGGAAGATGTCGTTACCTTGATGAGAAACACTTTGATGCGGCTACGGCATTGGCT
GGGTCTGGACCTGCTATCGCATGTGTTTTGCTTGACGCCATGGCGGATGGCGGTGTAATGATGGGCTTGTCCAGA
AGCGCAGCCTTGGAGCTCGCCGCTCAAACCTTTCAGGGCGCCGCTCGCATGGTGTTGCAAAATGCCCACCCCGCA
CAGATCAAAGATGCAGTTTGCACCCCTGGAGGATGTACAATTGCTGGGCTTTTGGCTCTTGAAGACGGTCGAGTG
CGCTCCACCATTGCTCGTGGTATTCAAGCAGCCACAGAGAGGGCCGGCGAGCTCGGCCAATTCTCGAAAAAATGA
Gene >AgabiH97|061960
ATGGGCTACACTCTTTGTGTTTTAGGTTTATCTCTTAATACACATAACGCCGCCATTGTCTAATCAGTACCCTTG
ATAGGATGTGGTACTATGGGCATTGCCATTCTATCTGGCGTGCTCGACTCCCTTGATACTTCTAAACATTCTCTC
ACCAACGGCACCAACGGCACCAAAGGTACCAATGGTACCAATGGTGTTCACAAGTGGGAGGCGCATACCCCTGGC
ACAGTTTCACCAGTTGGTCCGCCGGATGTTTCGACCCCTACACGCTTCATTGCTTGCGTGAGCCGTGAAGCGACG
GCGAAAAAACTAGTCAGCCTATTCGCAAGTATGGGCGAAGCAGCTAGTAACGTCGAGGTTCTCGCATTAAAAAAT
GTCCAGGCCGTTAAGCAGGCTGACGTTGTTCTCCTCTGGTATGTATAAACACTTTATCCGGACGCATTTATCAAT
GAATTTCTACAGCTGCAAGCCTCCAGTCGCTGAGAAGATCCTCAGTGAACAGGGAATGGGCGATGTTCTGCAGGG
CAAACTCCTTATCAGTATCCTCGCAGGTGTAACCATTTCCCAACTCACGGACTGGGTACCCCCTTCAACACGGGT
GGTCCGTGCTATGCCGAATACCCCTTGCAAAGTCCGTGTGCACATTTCTCCTTTTTCTTCACACTGTCTCTAACA
AGCAGAAAAAAAATTTCTTTTCGATTCTTTTCTTTTTTTGGACCACGATCAGATTCGCGAAGGAATGACTGTCGT
CACCACTTTACCACCCTCGCCGAATGAGGAAAGCGACGACGTCATCATTCTAAAAATATTTTCTTCCATTGGAAG
ATGTCGTTACCTTGATGAGAAACACTTTGATGCGGCTACGGCATTGGCTGGGTCTGGACCTGCTATCGCATGTGT
TTTGCTTGACGCCATGGCGGATGGCGGTGTAATGATGGGCTTGTCCAGAAGCGCAGCCTTGGAGCTCGCCGCTCA
AAGTCAGTCTTTCCCATTTTAGTTTTACCGAATCCATGGTACTGATCCCCGATGTTTTCTTTCATGTAGCCTTTC
AGGGCGCCGCTCGCATGGTGTTGCAAAATGCCCACCCCGCACAGATCAAAGATGCAGTTTGCAGTACGTTGATAT
TTTCTCCACTGTCGATTGTGCCTGAAACGTCATGTGAAAATCATAGCCCCTGGAGGATGTACAATTGCTGGGCTT
TTGGCTCTTGAAGACGGTCGAGTGCGCTCCACCATTGCTCGTGGTATTCAAGCAGCCACAGAGAGGGCCGGCGAG
CTCGGCCAATTCTCGAAAAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail