Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|061880
Gene name
Locationscaffold_3:2211951..2213705
Strand-
Gene length (bp)1754
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 5.2E-33 110 257

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 22 292 5.0E-48
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 39 289 5.0E-46
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 39 289 5.0E-46
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 65 269 8.0E-46
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 31 288 1.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 22 292 5.0E-48
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 39 289 5.0E-46
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 39 289 5.0E-46
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 65 269 8.0E-46
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 31 288 1.0E-44
sp|Q8NEB5|PLPP5_HUMAN Phospholipid phosphatase 5 OS=Homo sapiens GN=PLPP5 PE=1 SV=2 38 273 1.0E-44
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 54 287 2.0E-44
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 30 259 6.0E-42
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 33 258 1.0E-40
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 29 259 3.0E-39
sp|Q0WNG6|LPP4_ARATH Probable lipid phosphate phosphatase 4 OS=Arabidopsis thaliana GN=LPP4 PE=2 SV=1 25 258 4.0E-36
sp|Q8MXL9|Y5547_DICDI PA-phosphatase related-family protein DDB_G0275547 OS=Dictyostelium discoideum GN=DDB_G0275547 PE=3 SV=2 22 266 7.0E-32
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 21 266 2.0E-29
sp|Q54PR7|Y4367_DICDI PA-phosphatase related-family protein DDB_G0284367 OS=Dictyostelium discoideum GN=DDB_G0284367 PE=3 SV=1 100 268 4.0E-26
sp|Q04396|LPP1_YEAST Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPP1 PE=1 SV=1 105 260 5.0E-21
sp|Q9V576|WUN_DROME Putative phosphatidate phosphatase OS=Drosophila melanogaster GN=wun PE=1 SV=2 6 272 1.0E-16
sp|O08564|PLPP1_RAT Phospholipid phosphatase 1 OS=Rattus norvegicus GN=Plpp1 PE=1 SV=1 28 249 6.0E-15
sp|O88956|PLPP1_CAVPO Phospholipid phosphatase 1 OS=Cavia porcellus GN=PLPP1 PE=2 SV=1 25 293 9.0E-15
sp|O14494|PLPP1_HUMAN Phospholipid phosphatase 1 OS=Homo sapiens GN=PLPP1 PE=1 SV=1 112 299 3.0E-13
sp|Q99JY8|PLPP3_MOUSE Phospholipid phosphatase 3 OS=Mus musculus GN=Plpp3 PE=1 SV=1 14 287 3.0E-13
sp|Q61469|PLPP1_MOUSE Phospholipid phosphatase 1 OS=Mus musculus GN=Plpp1 PE=1 SV=1 25 249 4.0E-13
sp|P97544|PLPP3_RAT Phospholipid phosphatase 3 OS=Rattus norvegicus GN=Plpp3 PE=1 SV=1 14 287 2.0E-12
sp|Q9DAX2|PLPP2_MOUSE Phospholipid phosphatase 2 OS=Mus musculus GN=Plpp2 PE=1 SV=1 53 254 7.0E-11
sp|O43688|PLPP2_HUMAN Phospholipid phosphatase 2 OS=Homo sapiens GN=PLPP2 PE=1 SV=1 53 249 9.0E-11
sp|Q3SZE3|PLPP3_BOVIN Phospholipid phosphatase 3 OS=Bos taurus GN=PLPP3 PE=2 SV=1 14 249 1.0E-10
sp|A4II83|LPPR1_XENTR Lipid phosphate phosphatase-related protein type 1 OS=Xenopus tropicalis GN=lppr1 PE=2 SV=1 127 251 1.0E-10
sp|O14495|PLPP3_HUMAN Phospholipid phosphatase 3 OS=Homo sapiens GN=PLPP3 PE=1 SV=1 14 287 4.0E-10
sp|Q8BFZ2|LPPR1_MOUSE Lipid phosphate phosphatase-related protein type 1 OS=Mus musculus GN=Lppr1 PE=1 SV=1 127 251 5.0E-10
sp|Q6WAY2|LPPR1_RAT Lipid phosphate phosphatase-related protein type 1 OS=Rattus norvegicus GN=Lppr1 PE=2 SV=1 127 251 7.0E-10
sp|Q2HJ61|PLPP2_BOVIN Phospholipid phosphatase 2 OS=Bos taurus GN=PLPP2 PE=2 SV=1 53 254 1.0E-09
sp|Q8K593|PLPP2_RAT Phospholipid phosphatase 2 OS=Rattus norvegicus GN=Plpp2 PE=2 SV=1 53 249 2.0E-09
sp|Q8TBJ4|LPPR1_HUMAN Lipid phosphate phosphatase-related protein type 1 OS=Homo sapiens GN=LPPR1 PE=2 SV=1 127 251 4.0E-09
sp|Q8BJ52|LPPR5_MOUSE Lipid phosphate phosphatase-related protein type 5 OS=Mus musculus GN=Lppr5 PE=2 SV=1 127 251 8.0E-09
sp|Q32ZL2|LPPR5_HUMAN Lipid phosphate phosphatase-related protein type 5 OS=Homo sapiens GN=LPPR5 PE=2 SV=2 127 251 9.0E-09
sp|Q6IQH6|LPPR1_DANRE Lipid phosphate phosphatase-related protein type 1 OS=Danio rerio GN=lppr1 PE=2 SV=1 127 251 2.0E-08
sp|Q6GM05|LPPR5_XENLA Lipid phosphate phosphatase-related protein type 5 OS=Xenopus laevis GN=lppr5 PE=2 SV=2 127 251 2.0E-07
sp|Q10022|YSX3_CAEEL Uncharacterized protein T28D9.3 OS=Caenorhabditis elegans GN=T28D9.3 PE=1 SV=1 54 252 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 26 45 19
2 77 99 22
3 106 125 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|061880
MRFSLRPSRSSNRNGRPMSPIRRRKLLLSYVPDWLLTIVLAGIFFSLDKVEGYRRVFALEDTSLRHPYAVHERVP
NIALYFICFVAPFLLQPVVNVFTIRSWWDLHNSSLGLILSLALTGSVTQFSKITVGRPRPDIVDRCQPPIGATDP
EFGLSSWEICTQPDNGILRDGFRSFPSGHSSMSFAGLGFLSFYLAGKLHLFDKRGHTGKAWLSLAPFCCAALVAI
SRTMDYRHHWHDVLVGSLLGTVMAYFSYRQYYPPLESELSHRPFSPRIKREDDELIPTHNHHPSGSNFPFVQAPT
TSTQGNGQYTATNNDEYELDGTVLRPHTEPLEEIWKRDGPGVSDTDQSPSYEGGEQVYQANTAPSLPPIRTSSPP
QAYVYEPRAQPV*
Coding >AgabiH97|061880
ATGCGTTTCTCCCTCAGGCCCTCCCGTTCCTCCAACAGGAATGGGCGTCCCATGTCTCCAATTCGGCGGAGGAAA
CTCTTGTTGTCTTATGTCCCTGATTGGCTTCTTACCATAGTCCTCGCTGGCATCTTTTTTTCTCTTGACAAAGTG
GAAGGTTACCGTAGGGTGTTTGCATTGGAAGATACGTCGCTCCGTCATCCTTATGCCGTGCACGAGCGCGTTCCA
AATATCGCTCTCTACTTTATCTGCTTCGTCGCGCCGTTCTTGCTTCAACCAGTAGTTAATGTATTCACTATACGC
TCATGGTGGGACCTCCACAATTCATCCCTTGGATTAATCCTCTCTCTGGCGCTTACCGGTTCTGTGACGCAATTC
TCAAAAATAACAGTAGGAAGGCCTCGACCAGATATAGTTGATCGTTGCCAACCTCCTATTGGCGCCACTGATCCA
GAGTTTGGTTTGTCGAGCTGGGAAATCTGTACTCAGCCGGATAATGGTATACTCAGAGATGGTTTCCGTAGTTTC
CCCTCTGGTCATTCTAGCATGTCTTTTGCTGGACTTGGTTTCTTGTCGTTTTATCTCGCTGGGAAACTGCACTTG
TTCGATAAACGGGGCCATACTGGTAAAGCCTGGCTCTCTTTAGCGCCGTTTTGCTGTGCTGCCCTTGTTGCAATT
TCTCGCACAATGGATTACCGCCACCACTGGCATGACGTCCTCGTCGGCTCCCTTCTTGGTACTGTCATGGCATAC
TTTTCCTACCGCCAATACTATCCACCGCTCGAGTCTGAACTCTCCCACCGTCCCTTCTCTCCCCGCATCAAACGA
GAAGATGACGAACTTATTCCTACGCACAATCACCATCCCAGTGGTAGTAACTTTCCATTCGTTCAAGCTCCGACG
ACCTCGACTCAGGGAAATGGCCAATATACGGCTACTAATAATGACGAGTACGAATTGGACGGGACCGTTCTTCGT
CCACATACTGAACCGCTTGAAGAGATATGGAAGCGTGATGGCCCTGGAGTGTCCGACACGGATCAATCGCCAAGT
TATGAAGGAGGGGAACAAGTATACCAAGCGAATACTGCTCCTTCCTTGCCACCAATTCGGACGAGTTCGCCTCCT
CAGGCGTACGTATATGAGCCGAGGGCGCAGCCTGTTTAA
Transcript >AgabiH97|061880
ATGCGTTTCTCCCTCAGGCCCTCCCGTTCCTCCAACAGGAATGGGCGTCCCATGTCTCCAATTCGGCGGAGGAAA
CTCTTGTTGTCTTATGTCCCTGATTGGCTTCTTACCATAGTCCTCGCTGGCATCTTTTTTTCTCTTGACAAAGTG
GAAGGTTACCGTAGGGTGTTTGCATTGGAAGATACGTCGCTCCGTCATCCTTATGCCGTGCACGAGCGCGTTCCA
AATATCGCTCTCTACTTTATCTGCTTCGTCGCGCCGTTCTTGCTTCAACCAGTAGTTAATGTATTCACTATACGC
TCATGGTGGGACCTCCACAATTCATCCCTTGGATTAATCCTCTCTCTGGCGCTTACCGGTTCTGTGACGCAATTC
TCAAAAATAACAGTAGGAAGGCCTCGACCAGATATAGTTGATCGTTGCCAACCTCCTATTGGCGCCACTGATCCA
GAGTTTGGTTTGTCGAGCTGGGAAATCTGTACTCAGCCGGATAATGGTATACTCAGAGATGGTTTCCGTAGTTTC
CCCTCTGGTCATTCTAGCATGTCTTTTGCTGGACTTGGTTTCTTGTCGTTTTATCTCGCTGGGAAACTGCACTTG
TTCGATAAACGGGGCCATACTGGTAAAGCCTGGCTCTCTTTAGCGCCGTTTTGCTGTGCTGCCCTTGTTGCAATT
TCTCGCACAATGGATTACCGCCACCACTGGCATGACGTCCTCGTCGGCTCCCTTCTTGGTACTGTCATGGCATAC
TTTTCCTACCGCCAATACTATCCACCGCTCGAGTCTGAACTCTCCCACCGTCCCTTCTCTCCCCGCATCAAACGA
GAAGATGACGAACTTATTCCTACGCACAATCACCATCCCAGTGGTAGTAACTTTCCATTCGTTCAAGCTCCGACG
ACCTCGACTCAGGGAAATGGCCAATATACGGCTACTAATAATGACGAGTACGAATTGGACGGGACCGTTCTTCGT
CCACATACTGAACCGCTTGAAGAGATATGGAAGCGTGATGGCCCTGGAGTGTCCGACACGGATCAATCGCCAAGT
TATGAAGGAGGGGAACAAGTATACCAAGCGAATACTGCTCCTTCCTTGCCACCAATTCGGACGAGTTCGCCTCCT
CAGGCGTACGTATATGAGCCGAGGGCGCAGCCTGTTTAA
Gene >AgabiH97|061880
ATGCGTTTCTCCCTCAGGCCCTCCCGTTCCTCCAACAGGAATGGGCGTCCCATGTCTCCAATTCGGCGGAGGAAA
CTCTTGTTGTCTTATGTCCCTGATTGGTGAGCATTCCGAGGGCTTCTGTCGTATCACCGCTGACCAGGTTTCAAG
GCTTCTTACCATAGTCCTCGCGTATGTTCATTCTCCTGACTCTATCTCCGCCAACTCAACCTCTCTTCAAGTGGC
ATCTTTTTTTCTCTTGACAAAGTGGAAGGTTACCGTAGGGTGTTTGCATTGGAAGATACGTCGTAAGTTGCTGCA
CTGCCTCGAATTTACCATGAGGTCTCTAATCCCTGCTTCCCTCTCGACAGGCTCCGTCATCCGTGAGTTTGACCA
TTTCATCCTTTTACCTTTTGCCGACTGACAATCGTTGTCACTAGTTATGCCGTGCACGAGCGCGTTCCAGTATGT
CCTTTAACGTCTGATGACCGTCTTCATTTAACTTTTCTCTATAGAATATCGCTCTCTACTTTATCTGCTTCGTCG
CGCCGTTCTTGCTTCAACCAGTAGTTAATGTATTCACTATACGCTCATGGTGGGACCTCCACAATTGTACGTCAA
TCAAATACTCTTAACCTCGCACTCGTTAACGCATTTTTTCCGTTCGGACAGCATCCCTTGGATGTGCGTGTTGTT
GACGTCATTAAATAATGCTACCGCTGATGAGACGCTTCGCAGTAATCCTCTCTCTGGCGCTTACCGGTTCTGTGA
CGCAATTCTCAAAAATAACAGTAGGAAGGCCTCGACCAGGTACATCAACCCGGATAATTATTCAGAATTTGGTGC
TAACCTGCTTATAGATATAGTTGATCGTTGCCAACCTCCTATTGGCGCCACTGATCCAGAGTTTGGTTTGTCGAG
CTGGGAAATCTGTACTCAGCCGGATAATGGTATACTCAGAGATGGTTTCCGTAGTTTCCCCTCTGGTCATTCTAG
CAGTACGTCAATTCCTCTTTTATTGGCGAAATTACAGGTTTAAACATGTGTTTAGTGTCTTTTGCTGGACTTGGT
TTCTTGTCGTTTTATCTCGCTGGGAAACTGCACTTGTTCGATAAACGGGGCCATACTGTAAGTGATACCGTCAAA
TTATATTTCCAGCATATAGTTATCTTTTTTAGGGTAAAGCCTGGCTCTCTTTAGCGCCGTTTTGCTGTGCTGCCC
TTGTTGCAATTTCTCGCACAATGGATTACCGCCGTAAGTGCTTGGATAATCTTCCTCTTTCTTTGTGATATTGAC
CGCTTGATACAGACCACTGGCATGACGTCCTCGTCGGCTCCCTTCTTGGTACTGTCATGGCATACTTTTCCTACC
GCCAATACTATCCACCGCTCGAGTCTGAACTCTCCCACCGTCCCTTCTCTCCCCGCATCAAACGAGAAGATGACG
AACTTATTCCTACGCACAATCACCATCCCAGTGGTAGTAACTTTCCATTCGTTCAAGCTCCGACGACCTCGACTC
AGGGAAATGGCCAATATACGGCTACTAATAATGACGAGTACGAATTGGACGGGACCGTTCTTCGTCCACATACTG
AACCGCTTGAAGAGATATGGAAGCGTGATGGCCCTGGAGTGTCCGACACGGATCAATCGCCAAGTTATGAAGGAG
GGGAACAAGTATACCAAGCGAATACTGCTCCTTCCTTGCCACCAATTCGGACGAGTTCGCCTCCTCAGGCGTACG
TATATGAGCCGAGGGCGCAGCCTGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail