© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|061730 |
| Gene name | |
| Location | scaffold_3:2172496..2173071 |
| Strand | - |
| Gene length (bp) | 575 |
| Transcript length (bp) | 513 |
| Coding sequence length (bp) | 513 |
| Protein length (aa) | 171 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 25 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 7 | 29 | 22 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 14.63 | 5.89 | 23.36 |
| Initials | Initials knots | 13.43 | 5.56 | 21.29 |
| Pileal_Stipeal_center | Stage I stipe center | 5.53 | 1.76 | 9.29 |
| Pileal_Stipeal_shell | Stage I stipe shell | 8.89 | 3.19 | 14.58 |
| DIF_stipe_center | Stage II stipe center | 8.77 | 3.25 | 14.29 |
| DIF_stipe_shell | Stage II stipe shell | 10.40 | 4.09 | 16.71 |
| DIF_stipe_skin | Stage II stipe skin | 8.98 | 3.32 | 14.64 |
| DIF_cap_skin | Stage II cap skin | 7.69 | 2.71 | 12.67 |
| DIF_cap_tissue | Stage II cap tissue | 6.72 | 2.09 | 11.34 |
| DIF_gill_tissue | Stage II gill tissue | 5.25 | 1.63 | 8.88 |
| YFB_stipe_center | Young fruiting body stipe center | 17.33 | 6.99 | 27.67 |
| YFB_stipe_shell | Young fruiting body stipe shell | 17.83 | 7.75 | 27.91 |
| YFB_stipe_skin | Young fruiting body stipe skin | 10.70 | 4.22 | 17.19 |
| YFB_cap_skin | Young fruiting body cap skin | 9.16 | 3.48 | 14.84 |
| YFB_cap_tissue | Young fruiting body cap tissue | 10.73 | 4.22 | 17.24 |
| YFB_gill_tissue | Young fruiting body gill tissue | 10.02 | 3.58 | 16.45 |
| YFB_veil | Young fruiting body veil | 6.57 | 2.24 | 10.90 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.015819 | yes |
| Casing | YFB_stipe_center | 0.801872 | no |
| Casing | YFB_stipe_shell | 0.753760 | no |
| Casing | YFB_stipe_skin | 0.567498 | no |
| Casing | YFB_cap_skin | 0.326217 | no |
| Casing | YFB_cap_tissue | 0.574986 | no |
| Casing | YFB_gill_tissue | 0.478862 | no |
| Casing | YFB_veil | 0.057550 | no |
| Casing | Initials | 0.911334 | no |
| Casing | Pileal_Stipeal_center | 0.021322 | yes |
| Casing | Pileal_Stipeal_shell | 0.305339 | no |
| Casing | DIF_stipe_center | 0.285737 | no |
| Casing | DIF_stipe_shell | 0.522943 | no |
| Casing | DIF_stipe_skin | 0.320168 | no |
| Casing | DIF_cap_skin | 0.155171 | no |
| Casing | DIF_cap_tissue | 0.086750 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.002951 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.003365 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.114888 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.245224 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.112257 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.175153 | no |
| DIF_gill_tissue | YFB_veil | 0.746653 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.971626 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.297401 | no |
| YFB_stipe_center | YFB_cap_skin | 0.134719 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.302886 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.239098 | no |
| YFB_stipe_center | YFB_veil | 0.015819 | yes |
| YFB_stipe_shell | YFB_stipe_skin | 0.248658 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.110231 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.253577 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.200673 | no |
| YFB_stipe_shell | YFB_veil | 0.010093 | yes |
| YFB_stipe_skin | YFB_cap_skin | 0.820773 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.996589 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.935416 | no |
| YFB_stipe_skin | YFB_veil | 0.309546 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.818827 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.909947 | no |
| YFB_cap_skin | YFB_veil | 0.556131 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.932469 | no |
| YFB_cap_tissue | YFB_veil | 0.311558 | no |
| YFB_gill_tissue | YFB_veil | 0.423544 | no |
| Initials | DIF_gill_tissue | 0.023933 | yes |
| Initials | YFB_stipe_center | 0.653180 | no |
| Initials | YFB_stipe_shell | 0.595830 | no |
| Initials | YFB_stipe_skin | 0.699634 | no |
| Initials | YFB_cap_skin | 0.435074 | no |
| Initials | YFB_cap_tissue | 0.707856 | no |
| Initials | YFB_gill_tissue | 0.603614 | no |
| Initials | YFB_veil | 0.088442 | no |
| Initials | Pileal_Stipeal_center | 0.036683 | yes |
| Initials | Pileal_Stipeal_shell | 0.411038 | no |
| Initials | DIF_stipe_center | 0.388476 | no |
| Initials | DIF_stipe_shell | 0.655582 | no |
| Initials | DIF_stipe_skin | 0.427127 | no |
| Initials | DIF_cap_skin | 0.217423 | no |
| Initials | DIF_cap_tissue | 0.133000 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.956200 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.006387 | yes |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.004928 | yes |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.164623 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.325695 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.158637 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.237117 | no |
| Pileal_Stipeal_center | YFB_veil | 0.821524 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.386259 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.403915 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.190373 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.373583 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.591974 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.803778 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.306903 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.129965 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.104109 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.781875 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.971535 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.781355 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.878052 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.614692 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.987285 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.824372 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.989645 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.847924 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.666104 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.322969 | no |
| DIF_stipe_center | YFB_stipe_center | 0.118244 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.094821 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.760012 | no |
| DIF_stipe_center | YFB_cap_skin | 0.959045 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.759575 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.861261 | no |
| DIF_stipe_center | YFB_veil | 0.635217 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.804056 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.978913 | no |
| DIF_stipe_center | DIF_cap_skin | 0.862735 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.684684 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.142080 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.268970 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.222361 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.972224 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.862336 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.969739 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.965068 | no |
| DIF_stipe_shell | YFB_veil | 0.362726 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.840880 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.600779 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.419342 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.297581 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.139126 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.112257 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.794223 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.981545 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.793736 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.891404 | no |
| DIF_stipe_skin | YFB_veil | 0.595830 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.830937 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.647711 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.512844 | no |
| DIF_cap_skin | YFB_stipe_center | 0.051115 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.040058 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.552185 | no |
| DIF_cap_skin | YFB_cap_skin | 0.802144 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.551114 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.674015 | no |
| DIF_cap_skin | YFB_veil | 0.831086 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.869520 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.730621 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.025458 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.019987 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.371399 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.611300 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.368964 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.489964 | no |
| DIF_cap_tissue | YFB_veil | 0.980135 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|061730 MKQGTAMTLFLLAIFITMLLLAAAMIAFVCSRPPRVTEFTPRVWYTSDNGGNDPETLCNSINRLGRPPSYSSSLS SQRASSFFMIPDGTGMPYNASESFKNDIISVSPSKPVIVGSESMQGGMSMKLMVTPPTPSKARVDESTLEELSFD LCDDSDSDEDEEDEESDEVM* |
| Coding | >AgabiH97|061730 ATGAAGCAAGGAACAGCCATGACATTATTTCTCCTTGCAATCTTTATAACCATGCTACTCCTCGCTGCCGCTATG ATCGCATTCGTTTGCTCCCGTCCCCCTCGTGTGACTGAATTTACGCCTCGAGTCTGGTATACCTCCGACAACGGC GGCAACGATCCAGAAACTCTCTGCAATAGTATTAATCGCCTTGGCCGTCCGCCATCTTACTCCAGCAGTCTCTCC TCTCAGCGAGCATCATCCTTCTTCATGATACCTGATGGAACTGGAATGCCATATAATGCTTCTGAATCATTCAAG AACGATATAATTTCCGTATCACCGTCGAAACCAGTTATAGTAGGGAGCGAGAGCATGCAGGGAGGAATGAGTATG AAGTTGATGGTTACCCCGCCCACACCGTCAAAGGCTAGAGTTGATGAGAGCACATTAGAGGAGCTGAGTTTTGAT TTATGCGACGATTCGGACAGTGATGAGGATGAAGAGGACGAAGAGTCTGACGAGGTCATGTAG |
| Transcript | >AgabiH97|061730 ATGAAGCAAGGAACAGCCATGACATTATTTCTCCTTGCAATCTTTATAACCATGCTACTCCTCGCTGCCGCTATG ATCGCATTCGTTTGCTCCCGTCCCCCTCGTGTGACTGAATTTACGCCTCGAGTCTGGTATACCTCCGACAACGGC GGCAACGATCCAGAAACTCTCTGCAATAGTATTAATCGCCTTGGCCGTCCGCCATCTTACTCCAGCAGTCTCTCC TCTCAGCGAGCATCATCCTTCTTCATGATACCTGATGGAACTGGAATGCCATATAATGCTTCTGAATCATTCAAG AACGATATAATTTCCGTATCACCGTCGAAACCAGTTATAGTAGGGAGCGAGAGCATGCAGGGAGGAATGAGTATG AAGTTGATGGTTACCCCGCCCACACCGTCAAAGGCTAGAGTTGATGAGAGCACATTAGAGGAGCTGAGTTTTGAT TTATGCGACGATTCGGACAGTGATGAGGATGAAGAGGACGAAGAGTCTGACGAGGTCATGTAG |
| Gene | >AgabiH97|061730 ATGAAGCAAGGAACAGCCAGTGCGTCGTGATCCTTGTCAAAGCGTTATCGTCGAAGTCCTTTTCTAACGATTCTC GTACAGTGACATTATTTCTCCTTGCAATCTTTATAACCATGCTACTCCTCGCTGCCGCTATGATCGCATTCGTTT GCTCCCGTCCCCCTCGTGTGACTGAATTTACGCCTCGAGTCTGGTATACCTCCGACAACGGCGGCAACGATCCAG AAACTCTCTGCAATAGTATTAATCGCCTTGGCCGTCCGCCATCTTACTCCAGCAGTCTCTCCTCTCAGCGAGCAT CATCCTTCTTCATGATACCTGATGGAACTGGAATGCCATATAATGCTTCTGAATCATTCAAGAACGATATAATTT CCGTATCACCGTCGAAACCAGTTATAGTAGGGAGCGAGAGCATGCAGGGAGGAATGAGTATGAAGTTGATGGTTA CCCCGCCCACACCGTCAAAGGCTAGAGTTGATGAGAGCACATTAGAGGAGCTGAGTTTTGATTTATGCGACGATT CGGACAGTGATGAGGATGAAGAGGACGAAGAGTCTGACGAGGTCATGTAG |