Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|061730
Gene name
Locationscaffold_3:2172496..2173071
Strand-
Gene length (bp)575
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 14.63 5.89 23.36
Initials Initials knots 13.43 5.56 21.29
Pileal_Stipeal_center Stage I stipe center 5.53 1.76 9.29
Pileal_Stipeal_shell Stage I stipe shell 8.89 3.19 14.58
DIF_stipe_center Stage II stipe center 8.77 3.25 14.29
DIF_stipe_shell Stage II stipe shell 10.40 4.09 16.71
DIF_stipe_skin Stage II stipe skin 8.98 3.32 14.64
DIF_cap_skin Stage II cap skin 7.69 2.71 12.67
DIF_cap_tissue Stage II cap tissue 6.72 2.09 11.34
DIF_gill_tissue Stage II gill tissue 5.25 1.63 8.88
YFB_stipe_center Young fruiting body stipe center 17.33 6.99 27.67
YFB_stipe_shell Young fruiting body stipe shell 17.83 7.75 27.91
YFB_stipe_skin Young fruiting body stipe skin 10.70 4.22 17.19
YFB_cap_skin Young fruiting body cap skin 9.16 3.48 14.84
YFB_cap_tissue Young fruiting body cap tissue 10.73 4.22 17.24
YFB_gill_tissue Young fruiting body gill tissue 10.02 3.58 16.45
YFB_veil Young fruiting body veil 6.57 2.24 10.90

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.015819 yes
Casing YFB_stipe_center 0.801872 no
Casing YFB_stipe_shell 0.753760 no
Casing YFB_stipe_skin 0.567498 no
Casing YFB_cap_skin 0.326217 no
Casing YFB_cap_tissue 0.574986 no
Casing YFB_gill_tissue 0.478862 no
Casing YFB_veil 0.057550 no
Casing Initials 0.911334 no
Casing Pileal_Stipeal_center 0.021322 yes
Casing Pileal_Stipeal_shell 0.305339 no
Casing DIF_stipe_center 0.285737 no
Casing DIF_stipe_shell 0.522943 no
Casing DIF_stipe_skin 0.320168 no
Casing DIF_cap_skin 0.155171 no
Casing DIF_cap_tissue 0.086750 no
DIF_gill_tissue YFB_stipe_center 0.002951 yes
DIF_gill_tissue YFB_stipe_shell 0.003365 yes
DIF_gill_tissue YFB_stipe_skin 0.114888 no
DIF_gill_tissue YFB_cap_skin 0.245224 no
DIF_gill_tissue YFB_cap_tissue 0.112257 no
DIF_gill_tissue YFB_gill_tissue 0.175153 no
DIF_gill_tissue YFB_veil 0.746653 no
YFB_stipe_center YFB_stipe_shell 0.971626 no
YFB_stipe_center YFB_stipe_skin 0.297401 no
YFB_stipe_center YFB_cap_skin 0.134719 no
YFB_stipe_center YFB_cap_tissue 0.302886 no
YFB_stipe_center YFB_gill_tissue 0.239098 no
YFB_stipe_center YFB_veil 0.015819 yes
YFB_stipe_shell YFB_stipe_skin 0.248658 no
YFB_stipe_shell YFB_cap_skin 0.110231 no
YFB_stipe_shell YFB_cap_tissue 0.253577 no
YFB_stipe_shell YFB_gill_tissue 0.200673 no
YFB_stipe_shell YFB_veil 0.010093 yes
YFB_stipe_skin YFB_cap_skin 0.820773 no
YFB_stipe_skin YFB_cap_tissue 0.996589 no
YFB_stipe_skin YFB_gill_tissue 0.935416 no
YFB_stipe_skin YFB_veil 0.309546 no
YFB_cap_skin YFB_cap_tissue 0.818827 no
YFB_cap_skin YFB_gill_tissue 0.909947 no
YFB_cap_skin YFB_veil 0.556131 no
YFB_cap_tissue YFB_gill_tissue 0.932469 no
YFB_cap_tissue YFB_veil 0.311558 no
YFB_gill_tissue YFB_veil 0.423544 no
Initials DIF_gill_tissue 0.023933 yes
Initials YFB_stipe_center 0.653180 no
Initials YFB_stipe_shell 0.595830 no
Initials YFB_stipe_skin 0.699634 no
Initials YFB_cap_skin 0.435074 no
Initials YFB_cap_tissue 0.707856 no
Initials YFB_gill_tissue 0.603614 no
Initials YFB_veil 0.088442 no
Initials Pileal_Stipeal_center 0.036683 yes
Initials Pileal_Stipeal_shell 0.411038 no
Initials DIF_stipe_center 0.388476 no
Initials DIF_stipe_shell 0.655582 no
Initials DIF_stipe_skin 0.427127 no
Initials DIF_cap_skin 0.217423 no
Initials DIF_cap_tissue 0.133000 no
Pileal_Stipeal_center DIF_gill_tissue 0.956200 no
Pileal_Stipeal_center YFB_stipe_center 0.006387 yes
Pileal_Stipeal_center YFB_stipe_shell 0.004928 yes
Pileal_Stipeal_center YFB_stipe_skin 0.164623 no
Pileal_Stipeal_center YFB_cap_skin 0.325695 no
Pileal_Stipeal_center YFB_cap_tissue 0.158637 no
Pileal_Stipeal_center YFB_gill_tissue 0.237117 no
Pileal_Stipeal_center YFB_veil 0.821524 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.386259 no
Pileal_Stipeal_center DIF_stipe_center 0.403915 no
Pileal_Stipeal_center DIF_stipe_shell 0.190373 no
Pileal_Stipeal_center DIF_stipe_skin 0.373583 no
Pileal_Stipeal_center DIF_cap_skin 0.591974 no
Pileal_Stipeal_center DIF_cap_tissue 0.803778 no
Pileal_Stipeal_shell DIF_gill_tissue 0.306903 no
Pileal_Stipeal_shell YFB_stipe_center 0.129965 no
Pileal_Stipeal_shell YFB_stipe_shell 0.104109 no
Pileal_Stipeal_shell YFB_stipe_skin 0.781875 no
Pileal_Stipeal_shell YFB_cap_skin 0.971535 no
Pileal_Stipeal_shell YFB_cap_tissue 0.781355 no
Pileal_Stipeal_shell YFB_gill_tissue 0.878052 no
Pileal_Stipeal_shell YFB_veil 0.614692 no
Pileal_Stipeal_shell DIF_stipe_center 0.987285 no
Pileal_Stipeal_shell DIF_stipe_shell 0.824372 no
Pileal_Stipeal_shell DIF_stipe_skin 0.989645 no
Pileal_Stipeal_shell DIF_cap_skin 0.847924 no
Pileal_Stipeal_shell DIF_cap_tissue 0.666104 no
DIF_stipe_center DIF_gill_tissue 0.322969 no
DIF_stipe_center YFB_stipe_center 0.118244 no
DIF_stipe_center YFB_stipe_shell 0.094821 no
DIF_stipe_center YFB_stipe_skin 0.760012 no
DIF_stipe_center YFB_cap_skin 0.959045 no
DIF_stipe_center YFB_cap_tissue 0.759575 no
DIF_stipe_center YFB_gill_tissue 0.861261 no
DIF_stipe_center YFB_veil 0.635217 no
DIF_stipe_center DIF_stipe_shell 0.804056 no
DIF_stipe_center DIF_stipe_skin 0.978913 no
DIF_stipe_center DIF_cap_skin 0.862735 no
DIF_stipe_center DIF_cap_tissue 0.684684 no
DIF_stipe_shell DIF_gill_tissue 0.142080 no
DIF_stipe_shell YFB_stipe_center 0.268970 no
DIF_stipe_shell YFB_stipe_shell 0.222361 no
DIF_stipe_shell YFB_stipe_skin 0.972224 no
DIF_stipe_shell YFB_cap_skin 0.862336 no
DIF_stipe_shell YFB_cap_tissue 0.969739 no
DIF_stipe_shell YFB_gill_tissue 0.965068 no
DIF_stipe_shell YFB_veil 0.362726 no
DIF_stipe_shell DIF_stipe_skin 0.840880 no
DIF_stipe_shell DIF_cap_skin 0.600779 no
DIF_stipe_shell DIF_cap_tissue 0.419342 no
DIF_stipe_skin DIF_gill_tissue 0.297581 no
DIF_stipe_skin YFB_stipe_center 0.139126 no
DIF_stipe_skin YFB_stipe_shell 0.112257 no
DIF_stipe_skin YFB_stipe_skin 0.794223 no
DIF_stipe_skin YFB_cap_skin 0.981545 no
DIF_stipe_skin YFB_cap_tissue 0.793736 no
DIF_stipe_skin YFB_gill_tissue 0.891404 no
DIF_stipe_skin YFB_veil 0.595830 no
DIF_stipe_skin DIF_cap_skin 0.830937 no
DIF_stipe_skin DIF_cap_tissue 0.647711 no
DIF_cap_skin DIF_gill_tissue 0.512844 no
DIF_cap_skin YFB_stipe_center 0.051115 no
DIF_cap_skin YFB_stipe_shell 0.040058 yes
DIF_cap_skin YFB_stipe_skin 0.552185 no
DIF_cap_skin YFB_cap_skin 0.802144 no
DIF_cap_skin YFB_cap_tissue 0.551114 no
DIF_cap_skin YFB_gill_tissue 0.674015 no
DIF_cap_skin YFB_veil 0.831086 no
DIF_cap_skin DIF_cap_tissue 0.869520 no
DIF_cap_tissue DIF_gill_tissue 0.730621 no
DIF_cap_tissue YFB_stipe_center 0.025458 yes
DIF_cap_tissue YFB_stipe_shell 0.019987 yes
DIF_cap_tissue YFB_stipe_skin 0.371399 no
DIF_cap_tissue YFB_cap_skin 0.611300 no
DIF_cap_tissue YFB_cap_tissue 0.368964 no
DIF_cap_tissue YFB_gill_tissue 0.489964 no
DIF_cap_tissue YFB_veil 0.980135 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|061730
MKQGTAMTLFLLAIFITMLLLAAAMIAFVCSRPPRVTEFTPRVWYTSDNGGNDPETLCNSINRLGRPPSYSSSLS
SQRASSFFMIPDGTGMPYNASESFKNDIISVSPSKPVIVGSESMQGGMSMKLMVTPPTPSKARVDESTLEELSFD
LCDDSDSDEDEEDEESDEVM*
Coding >AgabiH97|061730
ATGAAGCAAGGAACAGCCATGACATTATTTCTCCTTGCAATCTTTATAACCATGCTACTCCTCGCTGCCGCTATG
ATCGCATTCGTTTGCTCCCGTCCCCCTCGTGTGACTGAATTTACGCCTCGAGTCTGGTATACCTCCGACAACGGC
GGCAACGATCCAGAAACTCTCTGCAATAGTATTAATCGCCTTGGCCGTCCGCCATCTTACTCCAGCAGTCTCTCC
TCTCAGCGAGCATCATCCTTCTTCATGATACCTGATGGAACTGGAATGCCATATAATGCTTCTGAATCATTCAAG
AACGATATAATTTCCGTATCACCGTCGAAACCAGTTATAGTAGGGAGCGAGAGCATGCAGGGAGGAATGAGTATG
AAGTTGATGGTTACCCCGCCCACACCGTCAAAGGCTAGAGTTGATGAGAGCACATTAGAGGAGCTGAGTTTTGAT
TTATGCGACGATTCGGACAGTGATGAGGATGAAGAGGACGAAGAGTCTGACGAGGTCATGTAG
Transcript >AgabiH97|061730
ATGAAGCAAGGAACAGCCATGACATTATTTCTCCTTGCAATCTTTATAACCATGCTACTCCTCGCTGCCGCTATG
ATCGCATTCGTTTGCTCCCGTCCCCCTCGTGTGACTGAATTTACGCCTCGAGTCTGGTATACCTCCGACAACGGC
GGCAACGATCCAGAAACTCTCTGCAATAGTATTAATCGCCTTGGCCGTCCGCCATCTTACTCCAGCAGTCTCTCC
TCTCAGCGAGCATCATCCTTCTTCATGATACCTGATGGAACTGGAATGCCATATAATGCTTCTGAATCATTCAAG
AACGATATAATTTCCGTATCACCGTCGAAACCAGTTATAGTAGGGAGCGAGAGCATGCAGGGAGGAATGAGTATG
AAGTTGATGGTTACCCCGCCCACACCGTCAAAGGCTAGAGTTGATGAGAGCACATTAGAGGAGCTGAGTTTTGAT
TTATGCGACGATTCGGACAGTGATGAGGATGAAGAGGACGAAGAGTCTGACGAGGTCATGTAG
Gene >AgabiH97|061730
ATGAAGCAAGGAACAGCCAGTGCGTCGTGATCCTTGTCAAAGCGTTATCGTCGAAGTCCTTTTCTAACGATTCTC
GTACAGTGACATTATTTCTCCTTGCAATCTTTATAACCATGCTACTCCTCGCTGCCGCTATGATCGCATTCGTTT
GCTCCCGTCCCCCTCGTGTGACTGAATTTACGCCTCGAGTCTGGTATACCTCCGACAACGGCGGCAACGATCCAG
AAACTCTCTGCAATAGTATTAATCGCCTTGGCCGTCCGCCATCTTACTCCAGCAGTCTCTCCTCTCAGCGAGCAT
CATCCTTCTTCATGATACCTGATGGAACTGGAATGCCATATAATGCTTCTGAATCATTCAAGAACGATATAATTT
CCGTATCACCGTCGAAACCAGTTATAGTAGGGAGCGAGAGCATGCAGGGAGGAATGAGTATGAAGTTGATGGTTA
CCCCGCCCACACCGTCAAAGGCTAGAGTTGATGAGAGCACATTAGAGGAGCTGAGTTTTGATTTATGCGACGATT
CGGACAGTGATGAGGATGAAGAGGACGAAGAGTCTGACGAGGTCATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail