Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|061700
Gene name
Locationscaffold_3:2163371..2164399
Strand+
Gene length (bp)1028
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 50 143 2.0E-09
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 52 143 1.0E-08
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 61 144 5.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|061700
MRLDYALFALIAPLAVLGDLRHSGRRSHHDIAKRADASVQLHKRAFGHARWSFYDVGGAPGACGAYNSPGEHIVA
LNSAQYGSGYPGPMCGKTIVMTYNGKTTTAKITDECPGCPYGGLDLTRGLFGFFDTLDTGIIYGEWHFAGDDDEP
PAPKPTPKPSPKPKPTPKTTHTPPPPPPTTHHHTTTSTTHTTHKTTSTHEHSSTHSSTHSTSSSASSSSSASSSS
SNVSSASSAAIPTGVVSAGNAPGQNIAQCNKALLNMGNLIVAGGNA*
Coding >AgabiH97|061700
ATGCGTTTGGATTACGCTCTCTTTGCTCTCATCGCTCCTCTGGCCGTCCTCGGTGATCTTCGCCATAGTGGTCGT
CGCAGCCACCACGACATCGCAAAACGGGCTGACGCCTCCGTTCAACTGCACAAGCGTGCATTTGGTCATGCCCGT
TGGTCTTTCTACGACGTGGGAGGGGCTCCAGGTGCTTGTGGTGCATACAACAGTCCTGGCGAACATATTGTCGCC
CTCAACTCTGCGCAATACGGTAGCGGTTATCCAGGTCCCATGTGCGGGAAAACCATTGTCATGACATATAACGGG
AAGACGACCACTGCCAAGATCACAGACGAGTGCCCCGGATGCCCTTACGGGGGTTTAGACCTTACCCGTGGTCTC
TTTGGATTTTTCGATACACTCGACACAGGTATCATATATGGAGAATGGCACTTTGCAGGTGACGATGACGAGCCT
CCCGCACCCAAGCCTACCCCCAAACCCAGTCCAAAGCCCAAGCCCACGCCCAAGACTACCCATACACCTCCCCCA
CCTCCCCCTACCACTCATCACCATACTACTACTTCCACCACCCACACCACACACAAGACTACCTCCACCCATGAA
CACTCGTCAACCCACTCATCAACCCACTCCACCTCGTCTTCTGCGTCGTCTTCGTCCTCTGCGTCATCTTCATCT
TCCAATGTTTCTTCCGCATCCAGTGCTGCGATACCTACTGGCGTCGTTTCTGCCGGAAACGCTCCGGGTCAAAAT
ATCGCGCAGTGCAACAAGGCCCTCCTCAACATGGGTAACTTGATCGTTGCTGGTGGTAACGCTTGA
Transcript >AgabiH97|061700
ATGCGTTTGGATTACGCTCTCTTTGCTCTCATCGCTCCTCTGGCCGTCCTCGGTGATCTTCGCCATAGTGGTCGT
CGCAGCCACCACGACATCGCAAAACGGGCTGACGCCTCCGTTCAACTGCACAAGCGTGCATTTGGTCATGCCCGT
TGGTCTTTCTACGACGTGGGAGGGGCTCCAGGTGCTTGTGGTGCATACAACAGTCCTGGCGAACATATTGTCGCC
CTCAACTCTGCGCAATACGGTAGCGGTTATCCAGGTCCCATGTGCGGGAAAACCATTGTCATGACATATAACGGG
AAGACGACCACTGCCAAGATCACAGACGAGTGCCCCGGATGCCCTTACGGGGGTTTAGACCTTACCCGTGGTCTC
TTTGGATTTTTCGATACACTCGACACAGGTATCATATATGGAGAATGGCACTTTGCAGGTGACGATGACGAGCCT
CCCGCACCCAAGCCTACCCCCAAACCCAGTCCAAAGCCCAAGCCCACGCCCAAGACTACCCATACACCTCCCCCA
CCTCCCCCTACCACTCATCACCATACTACTACTTCCACCACCCACACCACACACAAGACTACCTCCACCCATGAA
CACTCGTCAACCCACTCATCAACCCACTCCACCTCGTCTTCTGCGTCGTCTTCGTCCTCTGCGTCATCTTCATCT
TCCAATGTTTCTTCCGCATCCAGTGCTGCGATACCTACTGGCGTCGTTTCTGCCGGAAACGCTCCGGGTCAAAAT
ATCGCGCAGTGCAACAAGGCCCTCCTCAACATGGGTAACTTGATCGTTGCTGGTGGTAACGCTTGA
Gene >AgabiH97|061700
ATGCGTTTGGATTACGCTCTCTTTGCTCTCATCGCTCCTCTGGCCGTCCTCGGTGATCTTCGCCATAGTGGTCGT
CGCAGCCACCACGACATCGCAAAACGGGCTGACGCCTCCGTTCAACTGCACAAGCGTGCATTTGGTCATGCCCGT
TGGTCTTTCTACGACGTGGGAGGGGCTCCGTACGTTCTTGCCAGCCACATTCTCGCATAGTTCTTCCTGACCTCT
ACATGTCCAGAGGTGCTTGTGGTGCATACAACAGTCCTGGCGAACATGTGAGTCTCTCAAATGTCAGCCTCCGAT
CCAGTTCACTAATGAATACTCAGATTGTCGCCCTCAACTCTGCGGTATGTGTCTCTTTGATACACCAATGTATGA
AGACGGCTTGACATCAAACGTAGCAATACGGTAGCGGTTATCCAGGTCCCATGTGCGGGAAAACCATTGTCATGA
CATATAACGGGAAGACGACCACTGCCAAGATCACAGACGAGGTATTGTGGCTGCATACTCAGCCGTTGAACCAGC
CTCTGACCCTCAGCTAGTGCCCCGGATGCCCTTACGGGGGTTTAGACCTTACCCGTGGTCTCTTTGGATTTTTCG
ATACACTCGACACAGGTATCATATATGGAGAATGGCACTTTGCAGGTGACGATGACGAGCCTCCCGCACCCAAGC
CTACCCCCAAACCCAGTCCAAAGCCCAAGCCCACGCCCAAGACTACCCATACACCTCCCCCACCTCCCCCTACCA
CTCATCACCATACTACTACTTCCACCACCCACACCACACACAAGACTACCTCCACCCATGAACACTCGTCAACCC
ACTCATCAACCCACTCCACCTCGTCTTCTGCGTCGTCTTCGTCCTCTGCGTCATCTTCATCTTCCAATGTTTCTT
CCGCATCCAGTGCTGCGATACCTACTGGCGTCGTTTCTGCCGGAAACGCTCCGGGTCAAAATATCGCGCAGTGCA
ACAAGGCCCTCCTCAACATGGGTAACTTGATCGTTGCTGGTGGTAACGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail