Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|061690
Gene name
Locationscaffold_3:2162031..2163056
Strand+
Gene length (bp)1025
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 56 128 2.0E-06
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 54 145 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 3 25 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|061690
MKVVNFGLFPALFFGGAAAVAVVAPKHGHNSFHHRDIANRTDESAHWKRVEHARWTFYDVGLGACGKTNVPSDFI
VALNSAQFGGGYPGPHCFQTITMKYGGKTAKAQIMDQCPGCPYGGLDLSRGLFDFFASEDLGVIYGSWSFGDSGG
DDGDDDPPKPTTTKRHHTTSKEKPTTTEKPEHTTSSKHRSTTSTVPSTTSTSSTPTSTSTSTEPSATSTSTSSDG
PANLNKFVLALDTLGGLVVAGSRLD*
Coding >AgabiH97|061690
ATGAAGGTTGTAAACTTTGGGCTGTTCCCTGCGCTTTTTTTCGGTGGTGCTGCAGCGGTTGCCGTGGTGGCGCCT
AAGCATGGCCATAACAGTTTCCATCATAGAGATATTGCCAATCGAACCGACGAAAGCGCGCACTGGAAACGCGTA
GAACACGCTAGATGGACATTCTATGATGTTGGGCTCGGTGCATGCGGCAAGACCAATGTCCCGTCGGATTTTATC
GTCGCCTTGAATTCAGCTCAATTCGGAGGTGGATACCCCGGTCCCCACTGCTTCCAGACGATCACGATGAAATAT
GGTGGTAAAACAGCCAAGGCGCAGATTATGGACCAGTGCCCCGGCTGTCCCTACGGTGGTCTTGATCTTTCAAGA
GGGCTTTTCGACTTTTTCGCCTCTGAAGACCTAGGTGTTATTTATGGCTCTTGGTCGTTTGGCGACAGTGGGGGT
GACGATGGGGATGACGACCCCCCCAAACCCACGACGACGAAAAGGCATCACACTACCTCGAAAGAAAAACCGACT
ACAACTGAAAAGCCAGAGCATACCACATCTTCAAAACATCGATCAACTACAAGCACTGTCCCTTCGACCACCAGC
ACAAGTAGTACACCCACCTCAACATCAACATCGACCGAACCCTCCGCAACCAGCACCAGCACGTCTAGTGACGGC
CCTGCGAACTTGAACAAATTTGTACTTGCACTTGATACGTTGGGCGGCCTTGTTGTTGCTGGCAGCCGGCTTGAT
TGA
Transcript >AgabiH97|061690
ATGAAGGTTGTAAACTTTGGGCTGTTCCCTGCGCTTTTTTTCGGTGGTGCTGCAGCGGTTGCCGTGGTGGCGCCT
AAGCATGGCCATAACAGTTTCCATCATAGAGATATTGCCAATCGAACCGACGAAAGCGCGCACTGGAAACGCGTA
GAACACGCTAGATGGACATTCTATGATGTTGGGCTCGGTGCATGCGGCAAGACCAATGTCCCGTCGGATTTTATC
GTCGCCTTGAATTCAGCTCAATTCGGAGGTGGATACCCCGGTCCCCACTGCTTCCAGACGATCACGATGAAATAT
GGTGGTAAAACAGCCAAGGCGCAGATTATGGACCAGTGCCCCGGCTGTCCCTACGGTGGTCTTGATCTTTCAAGA
GGGCTTTTCGACTTTTTCGCCTCTGAAGACCTAGGTGTTATTTATGGCTCTTGGTCGTTTGGCGACAGTGGGGGT
GACGATGGGGATGACGACCCCCCCAAACCCACGACGACGAAAAGGCATCACACTACCTCGAAAGAAAAACCGACT
ACAACTGAAAAGCCAGAGCATACCACATCTTCAAAACATCGATCAACTACAAGCACTGTCCCTTCGACCACCAGC
ACAAGTAGTACACCCACCTCAACATCAACATCGACCGAACCCTCCGCAACCAGCACCAGCACGTCTAGTGACGGC
CCTGCGAACTTGAACAAATTTGTACTTGCACTTGATACGTTGGGCGGCCTTGTTGTTGCTGGCAGCCGGCTTGAT
TGA
Gene >AgabiH97|061690
ATGAAGGTTGTAAACTTTGGGCTGTTCCCTGCGCTTTTTTTCGGTGGTGCTGCAGCGGTTGCCGTGGTGGCGCCT
AAGCATGGCCATAACAGTTTCCATCATAGAGATATTGCCAATCGAACCGACGAAAGCGCGCACTGGAAACGCGTA
GAACACGCTAGATGGACATTCTATGATGTTGGGCTGTGAGTCGCTTTGTCTTTGGTTGGAAATCTTGTCAGGATT
GGATCCATCCGGGACTTTGTTTTCGAGTTCAGGAAACCTATACTGACACTATGCTTGGTGCAGCGGTGCATGCGG
CAAGACCAATGTCCCGTCGGATTTTGTGAGTAATTACGACTAGTTCTCTGTTTCAGCCACTTGAATAATTTCCAT
CGTGTTAGATCGTCGCCTTGAATTCAGCTGTACGTGATTTCTCGCGTTTTCACCTGATTATAGATTGTTAAACGA
GCAACACAGCAATTCGGAGGTGGATACCCCGGTCCCCACTGCTTCCAGACGATCACGATGAAATATGGTGGTAAA
ACAGCCAAGGCGCAGATTATGGACCAGGTGTGTCAAAGGCACAAACCAAATCTGAACCGCGAGAGATTGACATGA
ATTTTCAGTGCCCCGGCTGTCCCTACGGTGGTCTTGATCTTTCAAGAGGGCTTTTCGACTTTTTCGCCTCTGAAG
ACCTAGGTGTTATTTATGGCTCTTGGTCGTTTGGCGACAGTGGGGGTGACGATGGGGATGACGACCCCCCCAAAC
CCACGACGACGAAAAGGCATCACACTACCTCGAAAGAAAAACCGACTACAACTGAAAAGCCAGAGCATACCACAT
CTTCAAAACATCGATCAACTACAAGCACTGTCCCTTCGACCACCAGCACAAGTAGTACACCCACCTCAACATCAA
CATCGACCGAACCCTCCGCAACCAGCACCAGCACGTCTAGTGACGGCCCTGCGAACTTGAACAAATTTGTACTTG
CACTTGATACGTTGGGCGGCCTTGTTGTTGCTGGCAGCCGGCTTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail